KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_1562Help
Entry
BANAU_1562        CDS       T02050                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya00020  Citrate cycle (TCA cycle)
bya00640  Propanoate metabolism
bya00660  C5-Branched dibasic acid metabolism
bya01100  Metabolic pathways
bya01110  Biosynthesis of secondary metabolites
bya01120  Microbial metabolism in diverse environments
bya01130  Biosynthesis of antibiotics
bya01200  Carbon metabolism
Module
bya_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bya_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BANAU_1562 (sucC)
   00640 Propanoate metabolism
    BANAU_1562 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BANAU_1562 (sucC)
Enzymes [BR:bya01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BANAU_1562 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CCG49583
Position
1662627..1663784
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVEKAESLSSSVYVVKAQIHAGGRGKAGGV
KIAKTKDEVKEYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYVGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LNESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatacggggtgtctgttcct
gaaggtaaagtggcttttacagcagaggaagcagttgaaaaagcagagagcctgtcaagc
tcggtttatgtcgtaaaggcgcaaatccatgctggcggccgcggcaaagctggtggggta
aagattgcaaaaacaaaagatgaagtgaaagagtatgccgaagaactgttaggcaagacg
ctcgtcacacatcaaacgggtccggacggacaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaggaatactatgtcgggcttgtacttgaccgcgctacttcaaga
atcgttttaatggcgtctgaagaaggcggaacggagattgaagaagtagcggaaaaaaca
cctgaaaaaattaaaaaagcggtaattgatccggctgtcggccttcagggctatcaggca
agggaaattgcattcgcaattaacatcccgaaagagcttgtcggcaaagccgctaaattt
atgctcggtttatacaaagcatttgttgagaaggactgctccatcgccgagatcaaccct
ctcgtcgttacgggggacggaaacgtcatggcgctggatgctaagctgaacttcgacagc
aatgcgttatacagacaaaaagacattatggaatacagagatttagatgaagaagatccg
aaagaaatcgaagcgtcaaaatacgatttaagctacatttcccttgatggaaatatcggc
tgtatggtaaacggcgcgggtcttgcaatgtctacaatggatatcattaaacactacggc
ggagaacctgcaaacttccttgatgtcgggggcggcgcaaccgcagaaaaagttacggaa
gcttttaaaatcattctttccgatcaaaacgtaaaaggaattttcgttaatattttcgga
ggcatcatgaagtgtgatgtcatcgccgagggcgttgttgaagcgacgagacaagtcgga
ttgacattgccgctggtcgtgcgccttgaagggacaaacgtagatttaggaaagaaaatc
ctgaatgaatcaggcttaaacatcacatctgcggaatcaatggcagacggcgcacagaaa
atcgtatccttagtttag

DBGET integrated database retrieval system