KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_1596Help
Entry
BANAU_1596        CDS       T02050                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bya02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bya02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1693764..1694831
Genome map
AA seq 355 aa AA seqDB search
MIRVLVVDDSAFMRKMITDFLAAEVQIEVIGTARNGEEALKKIELLKPDVVTLDIEMPVM
NGTDTLRKIISIYKLPVIMVSSQTQQGKDRTINCLEMGAFDFITKPSGAISLDLYKIKEQ
LIERVIAAGLSRAQKPEAAVKESSIPERPALAGFERPKAKSAKQAVFIATSTGGPRALQK
VIPKLPKDLKAPVFVVQHMPEGFTASLADRLNHLSDIQVKEAENGEEAKDGWVYIAPGGK
NMTVAEEGGRLRIILDVHDTESRHKPSADYLFRSASRLSDYEKVAVIMTGMGSDGTEGVK
EMLRTGGVKTIAESDESCVVFGMPKSAIKAGLIHEIKHVEDIAASITGCVKKERV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgattcgtgtgcttgtcgttgatgactcagcttttatgagaaagatgattaccgatttt
ctggctgcggaagtgcagatagaagtcatcgggacagccagaaacggggaagaggcgctg
aagaaaatagagcttctcaaaccggatgttgtcacgcttgatattgaaatgccggtcatg
aacggaacggatacattgcggaagatcatcagcatatataaacttcccgtaatcatggta
tcgagccagacacaacaagggaaggaccgaacgatcaactgcctggaaatgggcgctttt
gattttatcaccaagccttccggagcgatttcccttgatctttataaaattaaagagcag
ctgattgagagggtgattgcagccgggctgtcccgcgcacaaaaacctgaggcggcagtg
aaagagtcttctatcccggaacgtccggctttagcgggatttgaaagaccgaaagcaaaa
tccgccaagcaggccgtattcatcgcgacctctacaggcggaccgcgggctctgcaaaag
gtgattccgaaactgccgaaggatttaaaggcgcctgtatttgtcgttcagcacatgcct
gaaggcttcaccgcttcacttgcagacagactcaaccatttgtcagatattcaggtcaaa
gaagcggaaaacggtgaagaagcgaaagacggatgggtgtacatcgcgcccggcggaaaa
aatatgacggttgcagaggaaggcggaaggctccgcatcattcttgacgttcatgatacg
gaaagccggcataaaccgtcagccgattatttgtttcggtcggcaagccgcttatccgat
tacgaaaaggtagccgtcattatgaccggcatgggcagcgacggaaccgaaggcgtaaaa
gaaatgctcagaacaggcggcgttaaaacgattgcggaatcggacgaatcctgtgttgtg
ttcggaatgccgaagtcagcgataaaggcgggcctcattcatgagattaaacatgtggaa
gatatcgcggcatccatcaccggatgtgtgaaaaaagagagggtgtga

DBGET integrated database retrieval system