KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_1834Help
Entry
BANAU_1834        CDS       T02050                                 

Gene name
folA3
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bya00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bya00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1988820..1989326
Genome map
AA seq 168 aa AA seqDB search
MLSLIACCDKSMAIGYENNLLYHIPEDMKRFKELTTGKLCIQGRLTYESIVNITGKPLQN
RRNIILTKNKDFKPDHSSFVYHSVADVLKLIRGQLDTNEEVMVIGGGAIYEAFLPHADKV
YLTIVDSVAANADTCFPRLADDWRVIEKDHRKAENNTTFNYSFVTYSK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctcttattgcttgctgcgacaaatcaatggccatcgggtatgagaataatttg
ctgtaccatattcctgaagacatgaaacgttttaaagaactcactacaggaaagctgtgt
atacagggaaggcttacatacgaatcaatcgtaaacattacaggaaaaccacttcagaat
cgaaggaatatcatattaaccaaaaacaaggatttcaagcctgatcactcttcttttgtt
tatcattcggttgccgatgtattaaagcttatacgtggtcaattggatacaaatgaagaa
gtaatggtcattggaggaggcgctatatacgaggcattcttaccacatgctgataaggtt
tatttaacgattgttgattcagtcgctgcgaatgcagatacatgttttccaaggttagct
gatgactggagagtaattgaaaaggatcacagaaaagcagaaaacaataccacatttaat
tattcatttgtgacttactcaaaataa

DBGET integrated database retrieval system