KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_1859Help
Entry
BANAU_1859        CDS       T02050                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bya00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bya00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2008800..2010137
Genome map
AA seq 445 aa AA seqDB search
MAHSHSGSVNYFESVNKVIYEGKESTNPLAFKYYNSQEVIGGKTMKEHLRFSIAYWHTFT
ADGTDIFGAATMQRPWDHYKGMDLARARVDAAFELFEKLDAPFFAFHDRDIAPEGSTLKE
TNQNLDIIVDMIKDYMRTSGVKLLWNTANMFTNPRFVHGAATSCNADVFAYAAAQVKKGL
ETAKELGAENYVFWGGREGYETLLNTDLKFELDNMARFMHMAVDYAKEIGYTGQFLIEPK
PKEPTTHQYDTDAATTIAFLKQYGLDNHFKLNLEANHATLAGHTFEHELRMARVHGLLGS
VDANQGDPLLGWDTDEFPTDLYSATLAMYEILQNGGLGSGGLNFDAKVRRSSFEPDDLLY
AHVAGMDTFARGLKAAHKLIEDRVFEDVIQHRYRSFTEGVGLEIAEGRADFKTLEQYALN
NQSIKNESGRQERLKAILNQYILQV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctcactctcattccggttcagtcaactattttgaaagcgtaaacaaagtgatttac
gaagggaaagaatccacgaatcctttagcatttaaatactataattctcaagaagtaatt
ggcggaaaaacgatgaaagagcatttgcgattttctattgcctattggcatacatttacc
gctgacggcacagacatttttggcgcagctacgatgcagagaccgtgggatcactataaa
ggcatggatctggcgagagcgagggtagatgcagcgtttgagctgtttgaaaaactggat
gcgccattttttgcttttcatgaccgggatatcgcaccggaaggaagtacgttaaaagag
acaaatcaaaatctggatataatcgtggacatgataaaagactacatgagaaccagcggc
gttaagctattatggaatactgcaaacatgtttacgaatccccgtttcgtccatggtgcg
gcgacttcttgtaatgcagatgtatttgcgtatgccgcagcccaagtaaaaaaaggatta
gaaaccgcaaaagagcttggcgccgagaactatgtattttggggcggacgtgaagggtac
gaaactttgttaaataccgatttaaaatttgagcttgataatatggccagatttatgcat
atggcagtggattatgcgaaggaaatcgggtatacagggcagtttttgattgaaccaaaa
ccaaaagagccgaccacccatcaatatgatacggacgcagcaacaaccattgccttttta
aagcaatatggcttagacaatcattttaaattaaatctcgaagccaatcatgccacatta
gccgggcatacattcgaacatgaattacgcatggcgagagtgcatggtctgcttggctct
gttgacgcgaatcagggtgatccgcttttaggctgggacacagatgaatttccgacagat
ttatattctgcgacattagcaatgtacgaaattctgcaaaatggcggtcttggaagcgga
ggattaaactttgacgcaaaggtcaggagatcttcttttgagcctgatgatttactatat
gcccatgttgcagggatggatacatttgcaagagggttgaaagccgcccacaaattaatc
gaagatcgtgtgtttgaagatgtgattcaacaccgttaccgcagctttactgaaggggtt
ggtcttgaaattgcagaaggaagagctgattttaagacacttgagcaatatgcgctaaac
aatcagtcaattaaaaacgaatcagggagacaggagcggttaaaagcgatattaaaccaa
tacattttacaggtataa

DBGET integrated database retrieval system