KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_1865Help
Entry
BANAU_1865        CDS       T02050                                 

Gene name
adh2
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BANAU_1865 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BANAU_1865 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    BANAU_1865 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BANAU_1865 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BANAU_1865 (adh2)
   00626 Naphthalene degradation
    BANAU_1865 (adh2)
Enzymes [BR:bya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BANAU_1865 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2018440..2019456)
Genome map
AA seq 338 aa AA seqDB search
MKAVVATKDKSIAIVQKELRPLRHGEAKVKMEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGIVTEIGEGVTSLKKGDRVSIAWMFESCGCCEYCLTGRETLCRDVKNAGYTVDGAMAEE
AIVAVDYAIKVPENLDPAAASSITCAGVTTYKAVKVSEIKPGQWIGVFGVGGLGNLAVQY
AKNVFNAKVIAFDISDEKLNFAKSLGADAVVNSLNEDPVAKAKEVTNDSGLDAVVITAVS
KTPFNQAIDVVKAGARVVAVGLPVDKMDLDIPRLVLDGIQVVGSLVGTREDLKEAFQFAA
DGKVVPKVTKRPIEDVNDIFEEMEQGKVTGRMVIDFTS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagtagtagcaacaaaagacaaaagtatagcgatcgtacaaaaagaattacgt
cctttgcgacatggtgaagccaaagttaagatggaatactgcggtgtatgtcatactgac
ttgcatgttaaaaatgctgatttcggggatgttactggcgtcactttaggtcatgaggga
ataggcattgtaactgagatcggtgaaggtgtaacaagtctgaaaaagggcgaccgcgtc
tctattgcctggatgtttgaaagctgcggctgctgtgaatattgcctaactggccgtgaa
accttgtgccgggatgtaaaaaatgccggctatacagttgacggcgcaatggctgaagaa
gcaatcgtagcggttgattatgcaataaaggtgccggaaaatttagatcctgcagcagca
agcagcattacttgtgcaggtgtaacaacttataaagcggttaaagtcagtgaaattaaa
ccaggtcaatggatcggtgtatttggagtcggcggtttaggcaacttggctgttcaatat
gcaaaaaatgtctttaacgctaaagtaattgctttcgacattagcgatgaaaaattgaat
tttgctaagagcttaggcgctgatgcggttgtaaacagtttaaacgaagaccccgtcgct
aaagcaaaagaagtgactaacgattcagggcttgatgctgtggtcatcacggctgtctct
aaaacccctttcaatcaagcgattgatgttgtaaaagcaggagcccgtgtagtcgctgtc
ggtttaccggtggacaaaatggatttagatattccccgtctcgtgttagatgggattcag
gtagtaggttcattagtaggtaccagagaagatttgaaggaagcttttcaatttgccgca
gacggtaaagttgtacctaaagtgacaaagcgcccgattgaagatgtgaatgatattttt
gaagaaatggagcaaggtaaagtgaccggccgcatggttatcgattttacttcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system