KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_1935Help
Entry
BANAU_1935        CDS       T02050                                 

Gene name
bglC
Definition
glycoside hydrolase family protein (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BANAU_1935 (bglC)
Enzymes [BR:bya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BANAU_1935 (bglC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2077301..2078806)
Genome map
AA seq 501 aa AA seqDB search
MKRSISIFITCLLIAVLTMGGLLPSPASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLK
GISSHGLQWYGDFVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPTVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQSLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLGQSREWLNYLDSKNISWVNWNLSDKQESS
SALKPGASKTGGWPLTDLTASGTFVRENIRGYKDSTKERPETPAQDNPTQEKGISVQYKA
GDGRVNSNQIRPQLHIKNNGDATVDLKDVTARYWYNVKNKGQNFDFDCDYAQIGCGNLTH
KFVTLHKPKQGADTYLELGFKTGTLSPGASTGNIQLRLHNDDWSNYAQSGDYSFFQSNTF
KTTKKITLYHQGKLIWGTEPN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtcaatttctatttttattacgtgtttattgattgcggtattgacaatgggc
ggcttgctgccttcgccggcatctgcagcagggacaaaaacgccagtagccaagaatggt
cagcttagcataaaaggtacacaactcgtaaaccgagacggcaaagcggtacaactgaaa
gggatcagttcacatggattgcaatggtatggcgatttcgtcaataaagacagcttaaaa
tggctgagagacgattggggcatcaccgttttccgcgcggcaatgtatacggcagatggc
ggttatattgacaacccgaccgtgaaaaataaagtaaaagaagcggttgaagcggcaaaa
gaacttgggatatatgtcatcattgactggcatatcttaaatgacggcaacccaaaccaa
aataaagagaaggcaaaagaatttttcaaggagatgtcaagtctttacggaaacacgcca
aacgtcatttatgaaattgcaaacgaaccaaacggtgacgtgaactggaagcgtgatatt
aaaccgtatgcggaagaagtgatttccgttatccgcaaaaatgatccagacaacatcatc
attgtcggaaccggtacatggagccaggatgtgaatgatgctgccgatgaccagctaaaa
gatgcaaacgtcatgtacgcgcttcatttttatgccggcacacacggccaatctttacgg
gataaagcaaactacgcactcagcaaaggagcgcctattttcgtgacggaatggggaaca
agcgatgcgtctggaaatggcggtgtattccttggccagtcgcgggaatggctgaattat
ctcgacagcaagaacatcagctgggtgaactggaatctttctgataagcaggaatcatcc
tcggctttaaagccgggagcatctaaaacaggcggctggccgcttacagatttaactgct
tcaggaacattcgttagagaaaacattcgcggctacaaagattcaacgaaagaacgccct
gaaacgccagcacaagataaccccacacaggaaaaaggtatttctgtacaatacaaagca
ggggatgggcgtgtgaacagcaatcaaatccgcccgcagcttcacataaaaaataacggc
gatgcgacggtggatttaaaagatgtcactgcccgttactggtataacgtgaaaaacaaa
ggccaaaactttgactttgactgtgactacgcgcagattggatgcggcaatctgacccac
aaatttgtgacgctgcataaacctaagcaaggtgcagatacctatctggaactggggttt
aaaacaggaacgctgtcaccgggagcaagcacagggaatattcagcttcgtcttcacaat
gatgactggagcaattatgcacaaagcggcgattattcctttttccaatcaaatacgttt
aaaacaacgaaaaaaatcacattatatcatcaaggaaaactgatttggggaacagaaccc
aattag

DBGET integrated database retrieval system