KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_1956Help
Entry
BANAU_1956        CDS       T02050                                 

Gene name
gtaB1
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bya00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bya00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bya00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bya00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2133531..2134424
Genome map
AA seq 297 aa AA seqDB search
MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAASGIEDILIITGR
NKRSIEDHFDRSAELEFNLREKGKTETLKEMQQIADLANIHYIRQKEPLGLGHAVLCAEH
FIGDEPFAVLLGDDIMVSDTPALSQLIDVYNQHGTETIGVQPVDPADVSKYGIIQTGRQS
GHVYQVEDLIEKPAVEKAPSHIAVMGRYILTPAIFKTLKTIGRGAGNEIQLTDALREVCR
TRSIYARELEGSRFDIGDKFGCFMAGTEIGLLREEMRPKLLAYLEEVLKRESEEIVR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagtgagaaaagcggtcattcccgcagcaggtttaggaacgagatttctg
ccggcgacaaaggcgcagccgaaagaaatgctgccgattgtcgacaaaccggccatccaa
tatattgtcgaagaggccgcagcgtcaggaattgaagatatactgattattacagggaga
aacaaacgctcgattgaagatcattttgaccggtcggcggaattggaattcaatctgcgg
gaaaaaggcaagacggagacgctgaaggagatgcagcagatcgccgatttggccaatatt
cattacatccgtcagaaagaaccgctcggattaggacatgcggtgctgtgtgcggagcat
tttatcggagatgagccttttgccgttctcttaggtgatgatattatggtatctgacact
cccgctctttcacagctcatagacgtctataaccaacacggcacagaaacgatcggcgta
cagcccgtcgatcctgctgatgtcagcaaatatggtattatacagacggggcggcagagc
ggtcatgtataccaggttgaggatctgattgagaaaccggctgttgaaaaggcgccctct
catattgccgtgatgggccgctacatattaacccctgctatttttaaaacgctgaagacg
atcggaagaggcgcgggcaacgaaatccaattgacagacgcgctgcgcgaagtgtgccgc
acccgaagcatttatgcgcgggagcttgaaggaagccggtttgatataggagataagttc
ggctgttttatggccggcacggagatcgggcttctgcgggaagaaatgagaccgaaactt
ttagcttatttagaagaggtgttaaaaagagaatctgaagaaatcgtgcgctaa

DBGET integrated database retrieval system