KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_2035Help
Entry
BANAU_2035        CDS       T02050                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BANAU_2035 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BANAU_2035 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BANAU_2035 (odhB)
Enzymes [BR:bya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BANAU_2035 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2244424..2245671)
Genome map
AA seq 415 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLKEVLK
DSGDTVQVGEIIGTITEGAGESSAPAPSESAPANEQTKEEAKAEPAAQEVSQEAQSEAKS
RTIASPAARKLAREKGIDLSQIPTGDPLGRVRKQDVEAYEKPASKPAAQPKQQAQKTQQS
FDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFLEQNDVK
LGFMSFFTKAVVAALKKFPLLNAEIQGDELIVKKFYDIGIAVAAEEGLVVPVVRDADRLT
FAGIEREIGELAKKARNNKLTLGELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMHKI
QLRPVAIDAERSENRPMMYIALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacgatagcccaa
tggttaaagcagcccggtgattatgtagaacagggtgagtacttgcttgaactggagacg
gacaaagtaaatgttgaattgacagcagaagaatcgggtgttctaaaagaggtattgaaa
gattcgggtgataccgtccaagtaggagaaattatcggtaccattacagaaggcgctggc
gaaagttctgcacccgccccttcagaaagtgctccagccaatgaacaaacgaaagaggaa
gcaaaagctgaacctgctgcacaagaagtcagccaggaagcacaatcagaagcgaaatcc
agaacgatagcgtctccggctgcacgcaagctggcaagggaaaaagggattgatctatca
caaattccgacgggggacccgctcggccgcgtgcgcaagcaagatgtggaagcttatgaa
aaaccggcttcaaaacctgcggcacagccgaaacagcaggctcaaaaaacacagcaaagc
tttgacaaacctgtcgaagtgcaaaaaatgtcccgccgcagacagacgatcgcgaaacga
ttggttgaagtgcagcagacttctgcgatgctgactacatttaacgaagttgacatgacg
gccgttatgaatctaagaaaacgccgtaaagaccaattccttgagcaaaacgatgtaaaa
ctcggtttcatgtcgttctttacaaaagccgtcgtggctgcattgaaaaaattcccgctc
cttaacgctgaaattcaaggcgatgagctgatcgtgaaaaaattctatgacatcggtatc
gctgtcgcggctgaagaagggcttgtcgtcccagtcgtgcgtgacgctgaccgcctgacg
tttgccggcattgaaagagagatcggcgaacttgcgaaaaaagcgcgaaacaataaatta
acattaggtgagctgcaaggaggctccttcacgatcacaaacggaggtacattcggatcg
cttatgtcaacaccgatcctaaacagccctcaggttgggatcttaggtatgcacaaaatt
cagctgcgcccagtagcgattgatgcggagcgctctgaaaaccgtccgatgatgtacatc
gctttatcatatgatcacagaattgtagatggtaaagaagcggtcggattcctcgtcacc
attaaaaacctgcttgaagatccggaacagctgttgctggaaggataa

DBGET integrated database retrieval system