KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_2060Help
Entry
BANAU_2060        CDS       T02050                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BANAU_2060 (bglA)
Enzymes [BR:bya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BANAU_2060 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2268709..2270151)
Genome map
AA seq 480 aa AA seqDB search
MGTLPKDFLWGGALAAHQFEGGWNKGGKGPSVVDVMTAGAHGVPRKITDTIEEREFYPNH
EAIDFYHRYKEDIALFSELGLKCLRTSIGWSRIFPKGDEAEPNEEGLAFYDRVFDELLKH
GIEPVITLSHFEMPLHLAREYGGFRNRKTVGFFVKFAEVCFERYKHKVKYWMTFNEINNK
MDVNNPIFLWTNSGVAVKENENAKEVMYQAGHHELLASALAVSKGRDINPEFRIGAMVSH
VPIYPYSSHPDDVMLAEETMRQRFFFPDVQVRGYYPSYALKEFEREGYQIHFEDGDEEIL
KNGRVDYLGFSYYMSTTVKSDVSNDNTGDVVNGGLPNGVDNPYITASDWGWAIDPTGLRY
TLNRLYDRYQIPLFIVENGFGAIDTLEEDGSIHDAARIEYLSSHIKALKKAITYDGVDVM
GYTPWGIIDIVSFTTGEMKKRYGMIYVDRDNEGNGSMRRLKKDSFEWYKKVIETNGSYVS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggggacattgccaaaagattttttatggggaggcgctctcgccgcacaccaatttgaa
gggggatggaataaaggcggcaaggggccgagtgtagtggacgtcatgacggcaggcgcg
catggtgtgccccggaaaataacagatacaattgaagagcgggaattttatccgaatcat
gaagcgatcgatttttatcatcgttataaagaggacatcgcattattcagcgagctgggt
ctgaaatgtttaagaacgtccatcggctggagcagaatttttcctaaaggtgatgaagcg
gagcccaatgaggaaggattggctttttacgaccgggtgtttgatgaattgctgaaacat
gggattgaaccggtaatcacgctgtcacattttgagatgccgctgcatttggcgagggaa
tacggcggtttcagaaacagaaaaacagtcggattttttgtgaaattcgctgaagtgtgt
tttgaacgctataaacataaggtgaagtattggatgacgtttaacgaaatcaataataag
atggatgtgaataatccgatctttttatggacgaactcgggcgtcgccgtcaaagaaaac
gaaaacgcaaaagaagtcatgtatcaggccggccatcacgaactgctggcaagcgcattg
gctgtttcgaagggaagagacatcaatcccgagttcaggatcggcgcgatggtatcacat
gttccgatttacccgtactcatctcaccccgatgatgtgatgctggctgaagaaacgatg
agacagcgttttttcttcccggacgtgcaggttcgcggatattatccaagctatgcgtta
aaagagtttgaaagagaaggctatcagatacactttgaagacggtgatgaagagattttg
aaaaacggccgggtggactatctcggattcagctattacatgtctacaaccgtaaaaagt
gatgtatcaaacgataataccggggatgtcgtaaacggaggattgccaaacggcgtggac
aatccttatattacagcgagtgattggggctgggcgattgacccgaccggtttacggtac
acattaaaccgcttatacgaccgctaccagattccattatttatcgtggaaaacggattc
ggcgccatcgacacattagaagaggacggttcaattcatgacgcagcaagaattgaatat
ttatcgtcacatataaaagctttgaaaaaagcaatcacatatgatggtgtggatgtaatg
ggctatacaccatggggaattattgatatcgtgtcatttacaaccggagaaatgaaaaaa
cgctacggcatgatttatgttgatcgggataatgaaggcaacggttcaatgaggcggctt
aagaaagactcatttgaatggtataaaaaagtgattgaaacaaacggctcatatgtatcc
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system