KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_2230Help
Entry
BANAU_2230        CDS       T02050                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya00260  Glycine, serine and threonine metabolism
bya00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bya01100  Metabolic pathways
bya01110  Biosynthesis of secondary metabolites
bya01130  Biosynthesis of antibiotics
bya01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BANAU_2230 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BANAU_2230 (trpA)
Enzymes [BR:bya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BANAU_2230 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA Ste50p-SAM
Motif
Other DBs
NCBI-ProteinID: CCG50251
Position
complement(2417531..2418328)
Genome map
AA seq 265 aa AA seqDB search
MFNLRDSEKLFIPFITAGDPLPDISVELAISLQNAGASALEIGVPYTDPLADGPVIQRAS
KRALENGMNIVKAIELGGKMKKNGVHIPIILFTYYNPVLQLEKEYFFALLRENDIDGLLV
PDLPLEESALLQMTCKKENIAYISLVAPTSEDRLKIITEQASGFVYCVSSLGVTGVRSEF
DPSVYSFIRKVKEFSSVPVAVGFGISNRKQVDGMNEISDGVVVGSALVKKVEELKTKLVN
PGTRADALLEFEEYAKTFGRLYSVK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatctgcgagattctgaaaaattatttatcccttttattacagctggcgatccg
cttcctgacatttctgttgagctggcaatatcattgcagaatgcaggcgcttctgccctt
gagatcggcgttccttacacagatccgctcgcggacggacccgtcatacaacgggcttca
aaacgggctctggaaaacggaatgaatatcgtaaaagcaattgaacttggcggcaaaatg
aaaaaaaacggcgttcatattccaattatcctctttacgtattataatcctgtgttacaa
ttagaaaaagaatactttttcgctttactgcgggaaaacgacatagacggtctgcttgta
cccgaccttccattagaggaaagcgcccttttgcaaatgacatgcaaaaaggagaacatc
gcttatatctcactggttgcgccgacaagtgaagaccgtttgaaaataattactgaacag
gccagcggctttgtgtattgtgtatcctctttaggagtgacgggcgtacgcagcgaattc
gatccgtctgtatactctttcattcgtaaggtgaaagaattcagctctgttccggtggcg
gtcggttttggcatttcaaaccgcaaacaggttgacgggatgaatgaaatatctgacggt
gtcgttgtcggcagcgcgcttgtcaaaaaagttgaagagcttaaaacaaagcttgtgaat
cccggaacaagagctgatgcgcttcttgaatttgaagaatacgcaaagacgttcggacga
ctgtacagtgtaaaatga

DBGET integrated database retrieval system