KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_2583Help
Entry
BANAU_2583        CDS       T02050                                 

Gene name
yrhJ
Definition
NADPH-ferrihemoprotein reductase (EC:1.14.14.1)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bya00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bya00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bya00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2788613..2791774)
Genome map
AA seq 1053 aa AA seqDB search
MKQLSAIPQPKTYGPLKNLPHLEKEKLSQSLWKIAEEYGPIFRFEFPSSVGVFVSGRELA
AEVCDEKRFDKNLSKALLKVREFGGDGLFTSWTHEKNWQKAHRILLPSFSQKAMKGYHSM
MLDIAMQLVQKWSRLNPNEEIDVAEDMTRLTLDTIGLCGFHYRFNSFYRDTQHSFITSML
RALQEAMRQAQRHSLQDKLMIKTRHQFQQDIEEMNSLVDRIIAERRENPDENLSDLLALM
LEAKDPVTGERLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLKNKDKLKKAVQEAERV
LTGETPEYKQIQQLTYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGKYPIAKGQPVTILT
PQLHRDKSAWGEDAESFRPERFSDPAAIPADAYKPFGNGQRACIGMQFALQEATMVLGLV
LKHFELIDHTDYELTIKEALTIKPGDFKIRVKNKDVSNQQSAQNHKAEGSGHKEEMKEIP
SHGTPLLILYGSNLGTAEGIAEELADIGRSKGFSTETGPLDDYAGKLPVKGAVVIVTASY
NGAPPDNAAGFVKWMETLEDQELKGVSYAVFGCGDRNWAATYQRIPRLIDKVLEEKGAKR
LTSIGEGDNADDFEYSQEAWEDSFWKDIMKAFHIEAAPKQTNKSQLSIEYVSEAAETPIA
KTYKAFEAEVITNKELHTESSKRSVRHIELRLPETETYQEGDHLGVLPQNSGELISRVIR
RFGLDPNQHFKIKGRQLPHLPMDRPVNAPELLASYVELQEPATRAQLRELAAHTVCPPHQ
KELEHLYSDDAAYKENVLKKRMTMLDLLEDYPACELPFERFLELLPSLKARYYSISSSPK
AASGELSITVGVVTAPAWSGRGEYRGVASNYLAGLQNGDPAVCFIRSPQSGFALPENPKT
PLIMVGAGTGIAPFRGFIQARAAEKMSGNSLGEAHLYFGCRHPEEDDLYKDEFDDAEKNG
LVTVHRAYSRLDQDCKVYVQDVLLREAAQIIALLDQGGHLYICGDGSKMAPAVENVLLQA
YEKVHNTDSKVSLNWLEQLQAEGRYAKDVWAGM
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagctaagcgctataccgcagccgaaaacatacgggcctctcaaaaatctccct
cacttggaaaaagaaaaactgtcacaatcgctttggaaaattgccgaagaatacggcccg
atctttcgttttgaatttccgagctctgtcggggtcttcgtatcaggccgcgagctcgcc
gcagaagtctgtgatgaaaagcgatttgacaaaaatctcagcaaagctctgctgaaagtc
cgtgaatttggcggtgacggactatttacgagctggactcacgaaaagaactggcagaaa
gcgcatcggattttattgccgagcttcagccagaaggcgatgaaaggctatcattcaatg
atgctggatattgccatgcagctcgtgcagaagtggagcagattaaatccgaatgaagaa
attgacgtcgccgaagatatgacgcgcctgacgctggatacaatcggcctgtgcggattt
cattaccgctttaacagcttttaccgcgacacacagcattcttttatcacaagtatgctt
cgtgcgctgcaggaggccatgcgccaagcgcaaagacacagcctgcaggacaagctgatg
atcaaaacgagacatcagttccagcaggatattgaagagatgaattcgcttgtagaccgg
atcatcgctgagcggagggaaaatccggatgaaaatctgtctgaccttttagcattgatg
cttgaagcgaaagaccctgtaacgggggaaaggctggatgatgaaaatatccgttatcaa
atcattacctttttgatcgcggggcatgaaaccacaagcgggttgctttcttttgcgata
tattgcctgctgaaaaataaagataaattgaaaaaagccgttcaggaagccgagcgggtg
ctgacgggagagacacctgaatataagcagattcagcagctgacatatatccgcatggtg
ctaaacgagactttgcggctgtatccgactgccccggcattttctctgtacgcgaaggaa
gatacggttctcggcgggaaatatccgattgcgaagggacagccggtgacgattctgact
ccgcagctgcaccgggataaaagtgcgtggggagaagatgccgagtcattccgcccggaa
aggttcagtgatcccgcggccattccggcagatgcgtataagccgttcggaaacggacag
cgcgcatgcatcgggatgcagtttgccctgcaggaagcgacaatggtgctcggccttgtc
ctgaaacactttgaactgattgatcatactgattatgagcttacgattaaagaagctcta
accattaagcccggtgattttaaaatccgtgtgaaaaacaaggacgtgtccaatcagcag
tccgcacaaaaccataaagctgaaggcagcggtcacaaagaagaaatgaaagaaatcccg
tcccacggaacgccgcttctcattctttacggatcaaatttaggaactgcggaaggaatc
gcggaagagctggctgatatcggaagaagcaaaggattttcaactgaaaccggaccgctc
gatgattatgccgggaaactgcctgtaaaaggcgcggtcgttattgttacggcttcttat
aacggggcgccgcctgataatgcggcgggttttgtgaaatggatggaaacccttgaagat
caggaattaaagggtgtttcttacgccgtcttcggctgcggagaccgcaactgggccgcc
acttaccagaggatcccccgcctgatagacaaagtgcttgaagaaaaaggggcaaaacgg
ctgacctctatcggggagggcgacaatgccgatgattttgagtacagtcaggaagcctgg
gaagactcattctggaaggacatcatgaaggcttttcatatagaggccgctccaaaacag
acaaacaaatcacagttatcaatcgaatacgtgagtgaagcagccgagacgccgattgcc
aaaacgtacaaagcatttgaggcggaggtcatcacgaacaaagagcttcataccgaaagc
agcaagcgctcagtccggcatattgagctgcgtctccccgaaacagaaacgtatcaggaa
ggagatcatctcggggtgcttccgcaaaacagcggggaactgatcagccgtgtcattcgc
cgattcggtcttgatccgaaccagcactttaagatcaagggccggcagctgcctcatctg
ccgatggaccggccggttaatgcgccggagcttttggcgtcctatgtagagctgcaggag
ccggcaacgagagcccagcttcgcgaacttgccgcacataccgtgtgcccgccgcaccaa
aaagaattggagcatctttattctgatgatgcggcatataaagaaaacgtgctgaaaaaa
cgaatgaccatgctggacctgttggaagattatcctgcatgtgaactgccgtttgagcgc
tttttagaacttctgccatccttaaaggcgcgctattattcaatctcaagctcaccgaag
gcagccagcggggagctcagtatcacggtcggcgttgtgacggctccggcatggagcggc
cgtggggaataccggggcgtggcttcgaactatttagccggattacagaatggcgatcct
gccgtctgtttcatccgctcgccgcagtcgggtttcgcattgcctgaaaatccgaaaacg
cctctcattatggtcggagcaggcacaggaattgcgccgttcaggggatttatccaggcg
cgggctgccgaaaaaatgtccggtaacagcctgggcgaagctcatttatacttcggctgc
cggcatcctgaagaagacgatctgtacaaagatgaattcgacgatgcggagaaaaacggc
cttgtcaccgtgcatcgggcgtattccagattagatcaggactgtaaagtttacgtacag
gatgtcctgcttcgcgaggctgcacaaattattgctctccttgaccaaggcggccatctc
tatatatgcggcgacggaagcaaaatggctccggccgtagaaaatgtactgcttcaggcg
tatgaaaaggtgcataacactgattcaaaagtttccttgaattggcttgaacagctgcag
gcggaaggaagatatgcgaaagatgtttgggcaggtatgtaa

DBGET integrated database retrieval system