KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_2668Help
Entry
BANAU_2668        CDS       T02050                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bya00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BANAU_2668 (recD)
Enzymes [BR:bya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BANAU_2668 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2861677..2864055)
Genome map
AA seq 792 aa AA seqDB search
MDQLNIEEQPYVKGVIHTVIYHNDTNLYTVLKVKVAETSEAIEDKVVSVTGYFPLLQEDE
TYTFYGKTATHPKFGLQFQAEHFKKEIPTTKEGIIHYLSSDLFEGIGKKTAEEIVKKLGD
GALNKILTDASVLYDVPKMSKKKADKLAGELQRHQGLEQIMISLNQYGFGPQLSMKIYQA
YETETLEKIQENPYQLVKDVEGIGFVKADELGGKMGLSGNHPERIKAAILYTIESTCLSE
GHTYIETKQLIINTQTLLNQSAEGGRVTEMDAADGIIALGESKDIVIEGERCYFPSLFYA
EQNVAKRVLDIAAQTEYADQFPESEFLLALGELEERMNVQYAPSQKDAIQKALSSPMLLL
TGGPGTGKTTVIKGIVELYSELHGVSLDPGDYKKDETFPVLLAAPTGRAAKRMSESTGLP
AVTIHRLLGWNGAEGFTYNEDQPIEGKLIIIDEASMLDIWLASHLFKALPKHIQLIVVGD
EDQLPSVGPGQVLRDLLASEVLPTVRLTDIYRQAEGSSIVELAHDMKKGLLPKGLTAPTK
DRSFIRCNSSQMKEVVDQVVSNALKKGYTSRDIQVLAPMYRGKAGINELNMLLQDIMNPP
KEKRRELKFGDVVYRTGDKILQLVNQPENNVFNGDIGEIVSIFYAKENTEKEDMVVVSFD
GNEITFTKKDFSQFTHAYCCSIHKSQGSEFPIVVLPVVKGYYRMLRRNLLYTAITRAKKF
LILCGEEEALEWGVKNNDATVRQTSLKNRLTEQTEEMDAELAALQKELPFSVYDANIGME
GITPFDFMEEKA
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
gtggatcagctgaacatcgaagaacagccgtatgtaaaaggcgtcattcatacggtcatt
tatcataatgacaccaacctgtatacagtgctgaaagtcaaagttgcagaaacgtctgag
gcgatcgaagacaaggtcgtatccgtaacgggctacttccctctgctgcaagaagatgag
acctacacattttatggaaaaaccgccacgcatcctaagttcggcctgcaatttcaggct
gaacactttaaaaaagaaattccgaccacaaaagaagggatcattcactatttatcaagt
gatctgtttgaaggaatcggaaaaaaaacggcggaagaaatcgtcaaaaagctcggagac
ggcgcgctcaataaaattctgacggatgcgtcggtgctttacgatgtgccgaaaatgtcg
aaaaagaaagcggataagcttgccggagagctgcagcggcatcaggggcttgagcagatt
atgatctctctgaaccaatacggtttcgggccccagctatcaatgaaaatatatcaggcc
tacgaaacggaaaccctggagaaaattcaggaaaatccttatcagcttgtaaaagacgtt
gaaggcatcggctttgtgaaagctgacgagctgggcggaaaaatgggtctgtcaggaaac
cacccggagcggatcaaagcggcaatcttatatacgattgaatcgacctgtctttcagaa
ggccatacgtacatagagacaaagcagctgattatcaatacgcaaacgctcctgaatcag
tcagctgaaggcggccgcgtcacggagatggatgcggctgacggcatcatcgccctcggg
gagagtaaggatatcgtcatagaaggagagcgctgctattttccgtccttgttttacgcc
gaacaaaatgtcgcaaaacgcgtgctcgacattgcggctcagacggagtatgccgatcaa
tttcctgaatcggaatttctgcttgcactcggtgaactggaagaacggatgaatgttcaa
tacgcaccaagccaaaaggatgccattcaaaaagcgctgtcttcaccgatgcttttattg
accggaggacccgggacggggaaaacgaccgttattaaaggaatcgtggaattatacagt
gaactgcacggagtatcgcttgaccccggtgattataaaaaagacgagacgttcccggtg
ctgcttgccgcgccgacgggaagagccgcaaaacggatgagcgaatctacggggctgccg
gctgttacgattcacaggctgctcggctggaatggcgctgaaggctttacctacaatgaa
gatcagccgattgaagggaaactgatcattatagacgaagcgagtatgctcgatatctgg
ctcgccagccatttgtttaaggcgcttcctaagcacattcagctcattgtcgtcggtgat
gaagaccagcttccttcagtaggaccggggcaggtgctcagagaccttttggcttctgag
gtgctgccgaccgtgcgtttgacagatatttaccgtcaggctgaaggatcatccattgtg
gaacttgcgcatgatatgaaaaaaggactgcttccaaaagggctgaccgcgccgacaaag
gaccgctcatttatccgctgtaattcttcacagatgaaagaagtcgtggatcaggtcgtc
tcgaacgcgttaaaaaaggggtatacctccagggatattcaagtgcttgccccgatgtac
aggggaaaagcgggaattaacgagctgaatatgcttcttcaagacatcatgaatccgccg
aaagaaaaaaggcgggagctgaaattcggtgatgtcgtctacaggacgggcgataaaata
ttacagcttgtcaaccagccggaaaacaatgtgtttaatggcgatatcggcgaaatcgtg
tccattttttatgccaaagaaaatacggaaaaagaagacatggtcgtcgtctcgtttgac
ggcaacgaaatcacctttacgaaaaaggatttcagccagtttacccacgcttactgctgt
tccattcataagtcgcagggaagcgaattcccgattgtcgtcctgcctgtcgtcaaaggc
tactatcgaatgctcaggagaaatctgctttataccgccataacaagggcgaaaaaattt
ctgattctttgcggagaagaagaagcgcttgaatggggcgtcaaaaacaatgatgccacc
gtcagacagacgtcgcttaaaaacaggctcacagagcagactgaagagatggatgcagaa
ctggccgccctgcaaaaagagctgccgttcagtgtatatgatgcgaacatcggaatggaa
ggcatcacgccgtttgactttatggaagaaaaagcgtaa

DBGET integrated database retrieval system