KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_2695Help
Entry
BANAU_2695        CDS       T02050                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.1.22.4)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bya00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BANAU_2695 (ruvA)
Enzymes [BR:bya01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BANAU_2695 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2891480..2892085)
Genome map
AA seq 201 aa AA seqDB search
MIEFVKGTIDYVSPQYIVIENGGIGYQVFTPNPFIYKVSNQETIFTYHHIKEDAFSLYGF
STREEKALFTKLLNVTGIGPKGALAILGSGDPGAVIEAIEQEDEAFLVKFPGVGKKTARQ
IILDLKGKLADVVPEMIDNLFNHEARIEKQEAETALDEALEALRVLGYAEKEIKKVLPHL
KEETALSTDQYVKKALQKLLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaattcgtgaaggggacgattgattacgtatctccccaatacatcgtgattgaa
aacggcggaatcggctatcaggtcttcactccgaatccgtttatttataaggtaagcaat
caagagaccatttttacgtatcatcatataaaagaagacgccttttctttgtacggtttt
tcaacccgggaagaaaaagcgcttttcacaaagctgctgaacgtcaccggcatcgggcct
aaaggggcgctcgccatcctcggttccggtgatcccggagccgtcatcgaagcgatcgaa
caggaagacgaagcctttttggtgaaatttccgggtgtgggcaaaaaaacggcgcggcag
attattcttgatttgaaaggcaaactggccgacgtcgtgcctgaaatgattgacaacctg
ttcaatcatgaagcgcgcattgaaaaacaagaggctgaaacggcgcttgacgaggcgctt
gaagcgctccgggttctcggctacgccgaaaaagaaattaaaaaagtgcttcctcactta
aaagaggaaacggcgctttcaacagatcaatatgtgaaaaaagcattgcaaaaattatta
aagtaa

DBGET integrated database retrieval system