KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_2729Help
Entry
BANAU_2729        CDS       T02050                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BANAU_2729 (hemB)
Enzymes [BR:bya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BANAU_2729 (hemB)
Exosome [BR:bya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BANAU_2729 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2923431..2924408)
Genome map
AA seq 325 aa AA seqDB search
MMNQTFNRHRRLRANAAMRDLVKETRLHPSDFIYPLFVVEGLEGKKEVPSMPGVYHVSLD
LLKDEMAELISLGIKSVIVFGVPEEKDACGTQAFHDHGIVQKGIAEIKKHYPEMIVIADT
CLCEYTDHGHCGVVKDGEILNDESLELLAQTAVSQAKAGADIIAPSNMMDGFVTVIREAL
DKEGFTNIPIMSYAVKYSSEFYGPFRDAADSTPQFGDRKTYQMDPANRLEALREAESDAA
EGADFLIVKPSMSYLDIMRDVKNRHHLPLVAYNVSGEYSMVKAAAQNGWIKEKEMVLEIL
TSMKRAGADLIMTYHAKDAAKWLAE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcaaacatttaacagacaccgccgtttgcgcgcgaacgctgcgatgagagat
ttagtaaaagaaacacgtcttcacccctcagattttatttacccgttatttgtcgttgaa
ggactcgaaggaaaaaaagaagttccttccatgccgggggtttatcatgtatcactcgat
ttgttaaaggatgaaatggctgagctgatatcgctcggcattaagtcagtcatcgttttc
ggcgtgccggaagaaaaagacgcctgcggaacccaggcttttcacgatcacggcattgtg
cagaaagggattgctgaaattaaaaagcattatcctgaaatgatcgtaatcgctgatacg
tgtctctgtgaatacacggatcacggccattgcggcgtcgtgaaagacggagaaatcctc
aatgacgagtcgcttgaactgctggcgcagacagccgtcagccaggccaaagcaggcgct
gacatcatcgctccttcaaatatgatggacggttttgtcacagtgatcagagaagcgctc
gacaaagaaggattcacgaatattccgatcatgtcttatgccgtgaaatattcaagtgaa
ttttacggtccgttccgcgacgcggctgacagcacgccgcagttcggagaccgaaaaaca
tatcagatggatccggccaaccgcttggaagcgctccgtgaggctgaatcagacgcggca
gaaggcgctgactttttaatcgtcaaaccgtctatgtcatacttagatattatgcgtgat
gtgaaaaaccgccatcacctgccgctggtcgcatataatgtgagcggggagtattccatg
gtgaaagcggcagcccaaaacggctggattaaagaaaaagaaatggtgctggaaatttta
acgagcatgaaacgtgcaggagccgatctgattatgacgtatcatgcaaaagacgcagca
aaatggcttgctgagtaa

DBGET integrated database retrieval system