KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_2775Help
Entry
BANAU_2775        CDS       T02050                                 

Gene name
ysiB
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BANAU_2775 (ysiB)
  Lipid metabolism
   00071 Fatty acid degradation
    BANAU_2775 (ysiB)
Enzymes [BR:bya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BANAU_2775 (ysiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2974053..2974832)
Genome map
AA seq 259 aa AA seqDB search
MNSLSMAVEQSVAVITINHQPANALSGAVLDELSGLFDRCETDDSVRSIIIRGEGKFFSA
GADIKEFTSLENLEQSSAMADKGQQLMERIEGFPKPVIAAIHGAAFGGGLELAMACHIRI
ATLDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALEMIGTSEPVTGEEALSLGLVTIGA
EHEEELLQKAKTLAGKFAEKSPQSMASLLELLYSNKIYSYDGGLKLEAKRFGEAFASDDA
KEGIQAFLEKRKPQFGGRR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcctttcgatggcggtagaacaatctgttgcggtgatcaccattaatcatcag
ccggccaacgcgctgtccggtgcggttttagatgagttgtccggtctgttcgaccggtgt
gaaacagatgacagcgtcagaagtatcattattcgcggtgagggaaaatttttctcggcg
ggcgccgatataaaggaatttacgtcgcttgaaaatcttgagcaatcttctgccatggcg
gataaaggccagcagctgatggaaagaattgaagggtttccgaagcccgttatcgcagcg
attcacggcgctgcgttcggcggcggtcttgagctagccatggcctgccatatcagaatc
gctacattggatgcaaagctcggcctgcccgagctgaatctcggcattattccgggcttt
gccgggacgcagcggcttccccggtacgtcggtacggcgaaagcgcttgaaatgatcggc
acttcagaacctgtgaccggagaagaagcgctcagcctcggccttgtcacgataggcgcc
gaacatgaggaagagctgctgcaaaaagcgaaaacgctcgcgggcaagtttgcggaaaaa
agcccgcagtcgatggcttctctgcttgagctcctttattcaaacaagatctattcttat
gacggcggcttaaagcttgaagcaaagcgctttggggaagcatttgcatcagatgacgca
aaagaaggcattcaggcatttctcgaaaaaagaaagcctcaattcggtgggcgaagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system