KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_2894Help
Entry
BANAU_2894        CDS       T02050                                 

Gene name
acsA3
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bya01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bya00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bya00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bya00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bya00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3101328..3103046)
Genome map
AA seq 572 aa AA seqDB search
MNLKALPAEKGNYHLRNYEETYRSFDWKEVEAEFSWHQTGKLNAAYEAIDRHAESFRKNK
VALYYKDANRDEKYTFKEMMEESNRAGNVLRRYGNVEKGDRVFIFMPRSPELYFIMLGAI
KIGAIAGPLFEAFMEGAVKDRLLNSQAKVVVTTPELAERIPADSLPDLEHIFIVGGSKEA
GDKIIHYDKAAEGESTRLDIEWMDRRDGYLLHYTSGSTGTPKGVLHVHEAMIQQYQTGKW
VLDLKEDDIYWCTADPGWVTGTVYGIFAPWLNGAANVIVGGRFSPENWYGTIEKLGVSVW
YSAPTAFRMLMGAGDEMASKFDLTSLRHVLSVGEPLNPEVIKWGHKVFGKRIHDTWWMTE
TGGQLICNYPCMEIKPGSMGKPIPGVEAAIVDNQGNELPPYRMGNLAIKKGWPSMMDSIW
NNKEKYDSYFMPGGWYVSGDSAYMDEDGYFWFQGRVDDVIMTSGERVGPFEVESKLVEHP
AIAEAGVIGKPDPVRGEIIKAFIALREGHEPSDQLKEDIRLFVKQGLAAHAAPREIEFKD
KLPKTRSGKIMRRVLKAWELNLPAGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgaaagcgttgccggcggaaaaggggaattatcatctgcgaaattatgaggaa
acgtaccgcagcttcgattggaaagaggtcgaagcggagttttcctggcatcagacgggg
aagctgaatgcggcgtatgaagcaattgaccgtcatgccgaatcatttcgaaaaaacaaa
gtagcgctgtattacaaggacgcaaaccgggatgaaaaatacacatttaaagaaatgatg
gaggaatcgaaccgggcgggaaatgtactgagacggtatggaaacgtggaaaaaggggac
cgcgtttttattttcatgccgcgttcgccggagctttactttatcatgctcggcgcaatt
aaaatcggtgcgattgccggtcctttatttgaagcgtttatggaaggcgccgtcaaagac
cgccttttgaacagccaggcaaaggttgtcgtgacgacacctgaactggccgaacggatt
ccggcggacagcctgcccgacctcgagcatattttcattgtcggcggcagcaaagaagcg
ggagataaaatcatccattatgataaagcggctgagggagaaagcacgagacttgatatt
gaatggatggacagaagagacggctacctgcttcactacacatcaggatctaccggaacg
cccaaaggtgtgctccacgttcatgaagccatgattcagcaataccagaccggcaagtgg
gtgcttgatcttaaagaagacgatatttactggtgcactgcggacccgggctgggtgacc
gggacggtgtacgggatatttgcgccgtggctgaacggagcggcgaatgtgatcgtcggc
ggcagattcagtccggaaaactggtacggcacgattgagaagctcggtgtcagcgtctgg
tacagcgctccgacggctttcagaatgcttatgggcgccggagatgaaatggcatccaaa
tttgaccttacttcacttcgtcacgtcctgagtgtcggagaacctttgaaccccgaggtc
atcaagtggggacataaagtattcggcaagcgcatccacgacacatggtggatgacagaa
acgggcggtcagctcatctgcaattatccttgcatggagatcaagccgggttcaatgggg
aaaccgattccgggagtggaagcggcgatcgttgacaatcagggaaatgagcttccgccg
taccgaatgggaaatctcgccattaaaaagggctggccgtcgatgatggattccatttgg
aataacaaagagaaatatgattcttatttcatgccgggcggctggtatgtttccggagat
tctgcttatatggatgaagacggttatttctggttccaaggcagagtcgatgatgtcatc
atgacatccggcgagcgcgtcggcccgtttgaagtcgaaagcaaacttgttgaacatccg
gcgattgccgaagccggcgttatcggaaagccggaccctgtccggggagaaattattaaa
gcgtttatcgcgctcagagaagggcatgagccatccgatcagctgaaggaggacattcgc
ctctttgtaaaacaggggcttgccgcgcatgccgcaccgcgggaaattgaattcaaagat
aaacttccaaaaacacggagcggaaaaatcatgagacgtgtgctgaaggcatgggagctg
aacctgccggcaggcgacctgtccacaatggaagattaa

DBGET integrated database retrieval system