KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_2924Help
Entry
BANAU_2924        CDS       T02050                                 

Gene name
ytjP
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BANAU_2924 (ytjP)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BANAU_2924 (ytjP)
Enzymes [BR:bya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BANAU_2924 (ytjP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3129889..3131280)
Genome map
AA seq 463 aa AA seqDB search
MNWEVEVIRNKEDLIRDTQKFLQINSVMDETTAGPGRPFGEGVNASLTSLLEFGEKEGFT
VKNLDGYAGHIEWGTGDEIVGVLCHVDVVPPGDGWTSDPFSADIRDGRIYARGAIDDKGP
TMAAFYALKIVKDMQLPLSKRVRIIIGTDEESDWRCVDHYFKHEKMPDIGFAPDADFPII
NAEKGIIDASLRIAKSASDKDAKNGLLSFRSGLRLNMVPDAAEAVIEGNGLDAVHAYFSK
WLEQSKTQGEAVSENGKLTLRVYGKSCHAMEPDNGVNAGLKLAECLNGTELDGAGKHFVK
TVSDYFSNDTRGKKLKIDCRDDISGELTLNVGTFTYRKGEEGELGINIRYPVTSDSKVIR
DAFTSAEEFRLEEFKDSKPHHVSADHPLVKTLQKVYEGQTGKKADLISIGGGTYARSLSA
GVAFGPLFPGRPDSAHQKDEYIEIDDLLRSTALYAEAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagttgaagtcatcagaaacaaagaagatctgatccgtgacacgcagaag
tttttgcagatcaacagcgtaatggacgaaacaacagccggtcccggccggccgtttgga
gaaggcgtcaatgccagcctgacgtcactgctggaattcggtgaaaaagaaggcttcacc
gtaaagaatcttgacggctatgcgggccatattgaatggggaacgggtgacgaaatcgtc
ggcgttctgtgccacgtcgatgtcgttccgcccggagacggctggacgagcgatccgttt
tcagccgatatcagggacggccggatatatgccagaggcgccattgatgataaagggccg
acaatggcggcgttttatgcgctgaaaatcgtcaaagacatgcagcttcctttatccaaa
cgcgtgagaatcatcatcggaacggatgaagaaagtgattggagatgcgtggatcactac
ttcaaacacgaaaaaatgcctgacatcggctttgctcctgacgcggattttccgatcatt
aacgcggaaaaaggaattatagatgcgtcactgcgcattgcaaaaagcgcttctgataaa
gacgcaaaaaacgggcttctgtccttccgttcaggactgcgcttgaacatggtgccggat
gcggctgaagcggttattgaagggaacggtcttgatgccgtgcacgcatatttcagcaaa
tggcttgagcagtcaaaaacacaaggtgaagcagtttcggaaaatggaaaactgacgctt
cgggtatacggaaaatcatgccatgcgatggaaccggataatggtgtcaatgccggctta
aagcttgctgaatgccttaacggaacggagctggatggagccggaaagcactttgtcaaa
accgtcagtgactatttttcaaatgatacacgaggcaaaaaactgaaaattgattgcagg
gatgacatcagcggagagcttacattgaatgtcggcacctttacatacagaaagggtgag
gaaggagaactcggcatcaacatccgttatcccgtcacttcagacagcaaagtcatccgt
gatgcttttacgtctgctgaagaattcaggcttgaagaatttaaagacagcaaaccgcac
cacgtttctgccgatcatccgctcgtaaagacgcttcaaaaggtttacgaaggacagacg
ggaaagaaagcggatctgatttcaatcggcggaggaacgtatgcgagatccctttcggcg
ggcgtcgcgttcgggccgctgttccccggccggcctgacagcgcgcatcaaaaggatgag
tacattgaaatcgatgaccttctccggtcaaccgctttatacgccgaagccatttatgag
cttgccaagtga

DBGET integrated database retrieval system