KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_2963Help
Entry
BANAU_2963        CDS       T02050                                 

Gene name
ytpA
Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BANAU_2963 (ytpA)
Enzymes [BR:bya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BANAU_2963 (ytpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3169819..3170598)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVGTIVIIHGASEYHGRYKWLVEMWRSSGYNVVMGDLPGQGTSTRARGHIRS
FQEYIDEVDIWIDKARTLEAPVFLLGHSMGGLIAIEWFKQQRNPRITALILSSPCLGLQI
KVNKVLDFASKGLNVLAPSLRVDSGLSPDMATRNADMIEADQNDSLYVTKVSVRWYRELL
KTIDAAMVPTDAFLKVPLLLMQGGDDKIVDKMKVRKWFSGVASHNKSYREWEGLYHEIFN
EPERETVFKAAKAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacttggaaagcagacaggcccgtcggtaccattgtcattatccacggggcgagc
gaataccacgggcgttataaatggctcgttgaaatgtggagatcttccggatataacgtg
gtgatgggcgatttgcccggtcagggaacgtcgacccgcgccagagggcatattcgctct
ttccaagaatacattgatgaagtagatatatggattgataaagcgagaacgcttgaagcg
cccgttttccttttgggccacagcatgggcggcctgattgcgatagaatggtttaagcag
cagagaaatccccgcattacggcactcattttatcatcaccttgtctgggtctgcaaata
aaagtcaataaagtcctagattttgcgtctaaaggactgaacgtcctcgctccgtccctc
agagtggattccggcttatcacctgatatggcaacgaggaatgcggatatgattgaagcg
gatcaaaacgactctttatatgtcacgaaggtatccgtaagatggtacagagagctttta
aaaaccattgatgccgctatggtgccgactgatgcgtttttaaaggtgccgcttttgctt
atgcagggcggtgatgacaaaatcgtcgataaaatgaaggtccgcaaatggttttccggt
gtggcttcccataataaatcgtaccgggaatgggaagggctttatcatgaaatttttaat
gaaccggaaagagaaactgtgtttaaggcggcaaaagcctttacagatcagtatatttga

DBGET integrated database retrieval system