KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_3125Help
Entry
BANAU_3125        CDS       T02050                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya00260  Glycine, serine and threonine metabolism
bya00750  Vitamin B6 metabolism
bya01100  Metabolic pathways
bya01110  Biosynthesis of secondary metabolites
bya01120  Microbial metabolism in diverse environments
bya01230  Biosynthesis of amino acids
Module
bya_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BANAU_3125 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BANAU_3125 (thrC)
Enzymes [BR:bya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BANAU_3125 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCG51146
Position
complement(3341389..3342456)
Genome map
AA seq 355 aa AA seqDB search
MELMWKGLIHQYKEFLPVTDRTPALTLHEGNTPLIHLPKLSEKLGIELHVKTEGVNPTGS
FKDRGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARAGMKCIVIIPDGKIAFGKLAQ
AVMYGAEIIAIDGNFDDALAIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGGAP
DILAIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGSAAIVRGEVIKNPETVATA
IRIGNPASWDKAVLAAEESAGKIDEVTDEEILHAYQLIAREEGVFAEPGSCASIAGVLKQ
VKSGEIPKGSKVVAVLTGNGLKDPNTAVDVSDIKPITLPTDEDSILEYLNGAARV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttggagctaatgtggaaaggacttatccatcaatataaagaatttctgccggtgacggat
cggacgccggccctgacattacatgaaggcaacacgccgctgattcacctgccgaagctt
tctgaaaagctcggaattgaactgcatgtgaaaacagagggcgttaatccgacggggtcc
tttaaggaccgcggcatggtcatggcggtcgccaaagcgaaagaagaaggcaatgatacc
atcatgtgcgcctctacaggcaacacatccgccgcggctgcggcatacgcggcgagagcc
ggcatgaaatgcatcgtcatcatcccggacggaaaaatcgccttcggaaaacttgcgcag
gccgtcatgtacggtgcggaaatcattgcgattgacggaaactttgacgacgcgctggcc
atcgtccggtcaatttgcgaaaaatcaccgattgcattagtgaattcagtaaacccttac
cggattgaagggcaaaaaacagcggcctttgaagtatgcgaacagctcggcggagcgccg
gacattctggcgatcccggtaggaaacgccgggaatatcacggcctactggaaagggttc
aaagaataccatgagaaaaacggcaccggacttccgaagatgcgcggttttgaggcggaa
ggttctgcggctatcgtccgcggcgaagtcattaaaaatccagagaccgttgcgacggca
atccgaatcgggaatcctgccagctgggacaaagcggtgctcgctgcggaagaatcagcc
ggaaaaattgatgaagtcacagatgaagaaattcttcacgcttatcagctgattgcccgt
gaagaaggcgtgtttgccgaaccgggctcctgtgcatccatcgccggcgttttgaaacag
gtgaaatccggtgaaattccaaaaggcagcaaggttgtcgcagttttgaccggaaacggc
ctgaaagatccgaacacggctgtggacgtttctgacataaaaccgattacgctgccgaca
gatgaggacagtattctggaatacttaaatggagcggcgcgtgtatga

DBGET integrated database retrieval system