KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_3498Help
Entry
BANAU_3498        CDS       T02050                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BANAU_3498 (rbsK)
Enzymes [BR:bya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BANAU_3498 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3746947..3747828
Genome map
AA seq 293 aa AA seqDB search
MSEICVIGSCSMDLVVTSDRRPKAGETVLGTDFQTVPGGKGANQAVAASRLGANVYMVGK
AGNDGYGKAIIENLKANGVNTDYMETVTHKKSGTAHIVLAEGDNSIVVVKGANDDISPDY
AKSALAKLPGIDIVLIQQEIPEETVEEVCSYCRAQQIPVILNPAPARPLKQSTIEDAAYL
TPNEHEASILFPDRTKEEALAGYPGKLFITEGKQGVRYSDGTAERLVPAFPAEAVDTTGA
GDTFNAALAVALAEGRDIEQALLFANRAASLSVQHFGAQGGMPARKEVEELLS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatttgtgttatcggaagctgttctatggacctggtcgtcacatccgatcgg
cgtccgaaagccggagaaaccgtactgggcacagactttcaaactgtgcccggaggaaaa
ggcgcaaaccaggccgtagccgcttcccgtctgggcgcaaacgtatatatggtaggaaaa
gcaggcaatgacggctacggaaaagcgattattgaaaacctgaaggcaaacggtgtcaat
acggactatatggaaacggttacacataaaaaaagcggaacggctcatattgtgctcgca
gaaggagacaacagcatcgtcgtcgtaaaaggcgcaaacgatgacatctcccccgattat
gccaaaagtgcgctagcaaaacttcccggcattgatatcgtgctgatccagcaggagatt
cctgaagaaaccgttgaagaagtgtgcagctactgccgcgcgcagcaaattccggttatc
ctgaatcccgcgccggcccggccgctgaaacaatcgacgattgaggatgccgcatatctt
acgccgaacgaacatgaagcatccattttatttcctgaccggacgaaagaagaagcgctc
gccggctatcccggcaaattgttcattaccgaaggaaaacaaggcgtgcgctactcagac
ggcaccgcggaacggcttgttcccgccttccctgcagaagcggtcgacacgacgggagcc
ggcgatacctttaatgcggcacttgccgtcgcactcgcggaaggacgggacatcgagcaa
gcgctcctgtttgccaaccgcgccgcctccctgtccgtgcagcacttcggcgcccaaggc
gggatgccggccagaaaagaagttgaggagctgctgtcatga

DBGET integrated database retrieval system