KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_3567Help
Entry
BANAU_3567        CDS       T02050                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Brite
Enzymes [BR:bya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     BANAU_3567 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3808042..3808683
Genome map
AA seq 213 aa AA seqDB search
MFKFKKKFLVGLTAAFISISMFSATASAAGTDYWQNWTDGGGTVNAVNGSGGNYSVNWSN
TGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRAPLIEYYVVDSWGTYRPTG
TYKGTVKSDGGTYDIYTTTRYNAPSIDGDNTTFTQYWSVRQSKRPTGSNAAITFSNHVNA
WKSHGMNLGSNWAYQVLATEGYKSSGSSNVTVW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtttaaaaagaaattcttagttggattaacggcagctttcataagtatcagc
atgttttcggcaaccgcctctgcagctggcacagattactggcaaaattggactgatggg
ggcggaacagtcaacgcagtcaatggatctggcgggaattacagtgttaattggtctaat
accggaaatttcgttgttggtaaaggctggactacaggctcgccatttagaacaataaac
tataatgccggagtctgggcgccgaatggcaatggatatttgactttatatggctggacg
agagcacctctcatcgaatattatgtagtggattcatggggtacttacagacctaccgga
acgtataaaggtactgtaaagagtgatggaggtacatatgacatatatacaacgacacgt
tataacgcaccttccattgatggcgataacactacttttacgcagtactggagtgttcgc
cagtcgaagaggccgaccggaagcaacgctgcaatcactttcagcaatcatgttaacgca
tggaagagtcatggaatgaatctgggcagtaattgggcttaccaagtcttagcgacagaa
ggatataaaagcagcggaagttctaatgtaacagtgtggtaa

DBGET integrated database retrieval system