KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_3581Help
Entry
BANAU_3581        CDS       T02050                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BANAU_3581 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BANAU_3581 (murA)
Enzymes [BR:bya01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BANAU_3581 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3819840..3821150)
Genome map
AA seq 436 aa AA seqDB search
MEKIIVRGGQKLNGTVKVEGAKNAVLPVIAASLLASEEKSVICDVPTLSDVYTINEVLRH
LGADVHFENNEVTVNASYALETEAPFEYVRKMRASVLVMGPLLARTGHSRVALPGGCAIG
SRPIDQHLKGFEAMGAKIKVGNGFIEAEVEGRLQGAKIYLDFPSVGATENLIMAAALAEG
TTTLENVAKEPEIVDLANYINAMGGKIRGAGTGTIKIEGVEKLHGVRHNIIPDRIEAGTF
MVAAAITEGNVLVKGAVPEHLTSLIAKMEEMGVKITDEGEGLRVIGPAQLKPIDIKTMPH
PGFPTDMQSQMMALLLRASGTSMITETVFENRFMHAEEFRRMNGDIKIEGRSVIINGPVQ
LQGAEVAATDLRAGAALILAGLVAEGHTRVTELKHLDRGYVNFHQKLAALGADIERVVDE
TAAEQESKEVVTDLNA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaatcatcgtccgcggcggtcagaagttaaacggcacagtgaaagttgaagga
gcaaaaaatgccgttttaccagttatcgctgcatctttattagcaagtgaagaaaaaagc
gtaatatgtgatgtacctacgctctccgatgtatatacaatcaacgaagtgttgcgtcat
ttaggagcagatgtgcattttgagaataatgaagttaccgtaaacgcttcttacgcttta
gaaacagaagcaccttttgaatatgtgcgtaaaatgcgcgcgtcagtgcttgttatgggc
cctctgttagcccgtacgggtcattcaagagtagcgcttccgggcggctgcgcaatcggc
tcaagaccgattgatcagcatttaaaaggctttgaagcaatgggtgcaaaaatcaaagta
ggcaacggctttattgaagcagaagtggaaggccgtctgcagggcgcaaaaatctattta
gatttcccaagtgtgggtgcgacagaaaacttgattatggcagctgctttagctgaagga
acaacaacgcttgaaaacgtggcaaaagagcctgaaatcgttgacttagcgaactatatc
aatgcgatgggcggaaaaatccgcggagccggcacaggcaccattaaaattgaaggtgtc
gagaagcttcacggcgtaagacacaacatcattcctgaccgtattgaagcgggtactttc
atggtggctgcggctatcacggaaggaaatgtattagtcaaaggtgcggttcctgagcat
cttacgtctttaattgcgaagatggaagaaatgggagtcaaaattacggatgaaggagaa
ggccttcgtgtcatcggtcctgcccagctgaagccgatcgacattaaaacgatgcctcac
ccaggattcccgactgatatgcagtcgcaaatgatggcgctgcttctccgtgcgagcgga
acaagcatgattactgaaactgtgtttgaaaaccgttttatgcatgctgaagaattccgc
cggatgaatggcgacattaaaattgaaggacgttctgtgatcattaacggtcctgtacag
ctgcaaggcgcagaagttgccgctacggacctgcgtgcgggcgcggcgctgattcttgcg
ggattagtggctgaaggtcatacacgcgtcacggaactgaagcacttggatcgcggttat
gtgaatttccatcaaaaacttgcggctctcggagctgacatcgagcgtgtcgttgatgaa
acggccgctgaacaagaaagcaaagaagtcgtaactgacctaaacgcataa

DBGET integrated database retrieval system