KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_3687Help
Entry
BANAU_3687        CDS       T02050                                 

Gene name
spsL
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:bya00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bya00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3923962..3924423)
Genome map
AA seq 153 aa AA seqDB search
MQVIEGVKIKKLIKHSDDRGFFSELVRDDEHLLERFGQASWSKSYPGVIKAFHYHEKQDD
LWFFPTGHAQVVLHDLREESATKGETDVYYMGEDNPMLLLIPKGVAHGYRVLGETPLTII
YFTTMSYNPDQPDEKRIPWNDDTIGFDWQTAHR
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtgatcgaaggcgtaaaaatcaaaaagctgatcaaacacagcgatgaccggggt
tttttctcagaactcgtccgtgacgatgaacatctcttagagcgtttcgggcaggcttcc
tggtccaaaagctatcccggcgtcattaaagcatttcactatcatgagaaacaggatgac
ctgtggtttttcccgacgggccacgcccaggtcgtgctccatgaccttcgcgaagagtcg
gcaaccaagggagaaacggatgtctactacatgggagaagacaatccgatgctccttctc
attcccaaaggcgtcgcacacgggtacagagtgctgggcgaaaccccgctgaccattatt
tatttcacgacaatgtcctacaatccggatcagcctgacgaaaaaagaattccgtggaat
gatgacaccatcggatttgactggcagacggctcaccggtag

DBGET integrated database retrieval system