KEGG   Burkholderia sp. YI23: BYI23_A002040Help
Entry
BYI23_A002040     CDS       T01711                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
byi  Burkholderia sp. YI23
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BYI23_A002040
   01230 Biosynthesis of amino acids
    BYI23_A002040
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BYI23_A002040
  Energy metabolism
   00680 Methane metabolism
    BYI23_A002040
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BYI23_A002040
Enzymes [BR:byi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BYI23_A002040
Exosome [BR:byi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BYI23_A002040
  Exosomal proteins of melanoma cells
   BYI23_A002040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(233400..234146)
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGVLLKEAGYKFDIAYTSVLKR
AIRTLWHVQDEMDQMYIPVVHSWRLNERHYGALAGLNKAETAKKYGDDQVLVWRRSYDTP
PPALAPDDERASFGDPRYAKVPREQLPLTECLKDTVARVLPFWNESIAPAIKSGKQIVIS
AHGNSIRALVKYLDNISDQDIVGLNIPNGVPLVYELDENLKPIKHYYLGDPEAIAAAQAA
VAKQGKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctagtgctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgacgtcgacctgaccgagcaaggcaaccgcgaggcgcgccaggccggc
gtgctgctcaaggaagccggctacaagttcgacatcgcctatacgtcggtgctgaagcgc
gcgatccgcacgctgtggcacgtgcaggacgagatggaccagatgtatatccccgtcgtg
cattcgtggcggctgaacgaacggcactacggcgcgctcgcgggtctgaacaaggccgaa
acggccaagaaatacggcgacgaccaggtgctcgtctggcgccgcagctacgacacgccg
ccgcccgcgctcgcaccggacgacgagcgcgcatccttcggcgacccgcgctacgcgaag
gtgccgcgcgagcaactgccgctcaccgaatgcctgaaggacaccgtcgcgcgcgtgctg
ccgttctggaacgagtcgatcgcgccggccatcaagtcgggcaagcagatcgtgatttcg
gcacacggcaactcgatccgcgcgctcgtgaagtacctggacaacatttccgaccaggac
atcgtcgggctgaatatcccgaacggcgtgccgctcgtctatgagctcgacgagaacctg
aagcccatcaagcactactacctgggcgatccggaagccatcgcggccgcgcaggcggct
gtcgccaagcagggcaaggcgggctga

DBGET integrated database retrieval system