KEGG   Burkholderia sp. YI23: BYI23_A004250Help
Entry
BYI23_A004250     CDS       T01711                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
byi  Burkholderia sp. YI23
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:byi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(480486..481040)
Genome map
AA seq 184 aa AA seqDB search
MTIAYLGLGANLGDARQTLKDAVVCLAQQHTITVLAKSSLYRTAPIDASGDDYFNCVVKL
ETSLPARSLLRLCHHIEEQFGRERPYRNAPRTLDLDILLYGASSIDEADLVVPHPRMTER
AFVLVPLVELEPELILPQRGRADAFIAGVADQRIEKVATCQCMAGAPARDANADTAPSNK
TDCR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgcttatctgggcctgggagcgaatctcggcgatgcgcgccagaccctgaaa
gacgcagtcgtgtgtctcgcccagcagcacacgatcaccgtgctcgcgaaatcgagcctg
tatcgcaccgcgccgatcgacgcttcgggcgacgattatttcaattgcgtcgtcaagctc
gaaacgagtctgccggcgcggtcgcttctgcgtctgtgtcatcacatcgaggagcagttc
ggccgcgagcggccctatcgcaatgcgccgcgcacgctcgacctggatattctgctgtac
ggcgcatcgagcatcgacgaagcggatctcgtcgtgccgcatccgcgcatgaccgaacgc
gccttcgtgctcgtgccgctcgtcgagctcgaacccgagctcattcttcctcaacgcggc
cgcgcggatgccttcattgccggcgtcgccgatcagcgcatcgagaaagtggcgacgtgc
cagtgcatggccggcgcgccagcgcgcgacgcgaacgccgacaccgccccttccaacaag
acagactgccgatga

DBGET integrated database retrieval system