KEGG   Burkholderia sp. YI23: BYI23_A004250Help
Entry
BYI23_A004250     CDS       T01711                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
byi  Burkholderia sp. YI23
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BYI23_A004250
Enzymes [BR:byi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BYI23_A004250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(480486..481040)
Genome map
AA seq 184 aa AA seqDB search
MTIAYLGLGANLGDARQTLKDAVVCLAQQHTITVLAKSSLYRTAPIDASGDDYFNCVVKL
ETSLPARSLLRLCHHIEEQFGRERPYRNAPRTLDLDILLYGASSIDEADLVVPHPRMTER
AFVLVPLVELEPELILPQRGRADAFIAGVADQRIEKVATCQCMAGAPARDANADTAPSNK
TDCR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgcttatctgggcctgggagcgaatctcggcgatgcgcgccagaccctgaaa
gacgcagtcgtgtgtctcgcccagcagcacacgatcaccgtgctcgcgaaatcgagcctg
tatcgcaccgcgccgatcgacgcttcgggcgacgattatttcaattgcgtcgtcaagctc
gaaacgagtctgccggcgcggtcgcttctgcgtctgtgtcatcacatcgaggagcagttc
ggccgcgagcggccctatcgcaatgcgccgcgcacgctcgacctggatattctgctgtac
ggcgcatcgagcatcgacgaagcggatctcgtcgtgccgcatccgcgcatgaccgaacgc
gccttcgtgctcgtgccgctcgtcgagctcgaacccgagctcattcttcctcaacgcggc
cgcgcggatgccttcattgccggcgtcgccgatcagcgcatcgagaaagtggcgacgtgc
cagtgcatggccggcgcgccagcgcgcgacgcgaacgccgacaccgccccttccaacaag
acagactgccgatga

DBGET integrated database retrieval system