KEGG   Burkholderia sp. YI23: BYI23_A004520Help
Entry
BYI23_A004520     CDS       T01711                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
byi  Burkholderia sp. YI23
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BYI23_A004520
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BYI23_A004520
   00640 Propanoate metabolism
    BYI23_A004520
   00660 C5-Branched dibasic acid metabolism
    BYI23_A004520
Enzymes [BR:byi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BYI23_A004520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:508184..509350
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPVFSVDDAVKAAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLLIEEGADIKKELYVGLVLDRVSQK
IVVMASSEGGMDIEEVAEKTPELLHKFAVEPSTGLQDKDADDLARKIGIPDASIPQARAI
LQGLYKAFFETDASLAEINPLIVTGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPNLKAILVNIFGGIMRCDVIAEGVIVASKAVDLKVPLVVRMKGTNEDLGKKM
LADSGLPIISADSMEEAAQKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggcgtcgcggtcccg
cgcggcaaacccgtgttctcggtggatgatgcggtcaaggccgcggaagagctgggcggc
ccggtctgggtcgtcaaggcgcagatccacgcgggcggccgcggcaagggcggcggcgtg
aaggtcgcgaagtcgatcgagcaggtccgcgaatacgcgaaccagatcctcggcatgcag
ctcgtcacgcaccagaccggcccggaaggccagaaggtgaaccgcctgctgatcgaagaa
ggcgctgacatcaagaaggaactgtacgtcggcctcgtgctcgaccgcgtttcgcagaag
atcgtcgtgatggcgtcgagcgaaggcggcatggacatcgaagaagtcgcggaaaagacg
ccggaactgctgcacaagttcgccgtcgagccgtcgacgggtctgcaggacaaggacgcc
gacgacctcgcacgcaagatcggcattccggacgcatcgatcccgcaagcgcgcgcgatc
ctgcagggcctctacaaggcgttcttcgaaaccgacgcatcgctcgcggaaatcaacccg
ctgatcgtgaccggcgacggcaaggtgatcgcgctcgacgccaagttcaacttcgattcg
aatgcgctcttccgtcatccggaaatcgtcgcgtaccgcgatctggacgaagaagatccg
gctgaagtcgaagcgtcgaagttcgatctcgcgtacatctcgctcgacggcaacatcggc
tgtctggtgaacggcgcgggcctggcgatggcgacgatggacaccatcaagctcttcggc
ggcgaaccggccaacttcctcgacgtcggcggtggcgcgacgaccgagaaggtcacggaa
gccttcaagctgatgctgaagaatccgaacctgaaggcgattctggtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgtggcgtcgaaggcggtggac
ctgaaggtgccgctcgtcgtgcgcatgaagggcacgaacgaggacctcggcaagaagatg
ctggccgactcgggtctgccgatcatctcggcggacagcatggaagaagccgcacagaag
gtcgtcgcggcagccgaaggcaagtaa

DBGET integrated database retrieval system