KEGG   Burkholderia sp. YI23: BYI23_A005480Help
Entry
BYI23_A005480     CDS       T01711                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
byi  Burkholderia sp. YI23
Pathway
byi01040  Biosynthesis of unsaturated fatty acids
byi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BYI23_A005480
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BYI23_A005480
Lipid biosynthesis proteins [BR:byi01004]
 Desaturase
  First
   BYI23_A005480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3 ZYG-11_interact DUF4294 Exonuc_VII_L
Motif
Other DBs
NCBI-ProteinID: AET88386
UniProt: G8M5A1
Position
1:626727..627923
Genome map
AA seq 398 aa AA seqDB search
MLNSSLEFLANGLLDFSWWQILLFTLAMTHVTIAGVTIYLHRCQAHRALDLHPVAAHFFR
FWLWMTTGMLTGQWAAIHRKHHAKCETEEDPHSPQTRGIWKVLLEGAELYRTEAKNEETM
RKFSHGTPNDWMERNVYTRYPILGISVMMVIDVALFGIVGLSVWAVQMIWIPFWAAGVVN
GLAHFWGYRNFNSADASTNIFPLGILIGGEELHNNHHTFATSAKLSSKWYEFDIGWMYIR
MMSMVGLAKVKKVAPTPKLAASKAVVDQDTLQAVLANRYEVMARYGKALKHAYAQELSKL
KEAGAREKYQLMRGARTWFHKEEDGLNEPQLKQLPELTSDNQKLRTFIELRKDLSAMWDR
SNASREQLVTQLQDWCHRAEESGIKALQDFALRLRRYA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaattcttcgctcgaatttctcgccaacggattgctcgacttttcctggtggcag
attctgctgttcacgctcgcgatgacgcacgtcaccatcgccggcgtcaccatctatctt
caccgttgccaggcgcaccgcgcgctggacctgcatcccgtcgcggcgcacttcttccgc
ttctggctgtggatgaccaccggcatgctgaccggccagtgggcggccatccatcgcaag
catcacgcgaagtgcgagaccgaggaagacccgcacagcccgcagacgcgcggcatctgg
aaagtgctgctcgaaggcgcggagctctatcgcaccgaagccaaaaacgaagaaacaatg
cgcaagttcagtcacggcacgccgaacgactggatggagcgcaacgtgtacacgcgttat
ccgattctcggcatcagcgtcatgatggtgatcgacgttgcgctgttcggcatcgtcggg
ctgtcggtgtgggctgtgcagatgatctggattcccttctgggcggcgggcgtcgtcaac
ggcctcgcgcacttctggggttatcgcaacttcaattcggcggatgcctcgacgaacatc
ttcccgctcggcattctgatcggcggcgaggagctgcataacaatcaccacacgttcgcg
acctcggcgaagctgtcgagcaagtggtacgagttcgatatcggctggatgtatatccgc
atgatgtcgatggtcggtctcgcgaaggtcaagaaggtcgcaccgacgccgaagctcgcc
gcgagcaaggcggtggtcgatcaggacacgctgcaggccgtgctcgcgaatcgctatgaa
gtgatggcgcgttacggcaaggcgctcaagcatgcctacgcgcaggaactgtccaagctg
aaggaagccggcgcgcgcgagaagtaccaattgatgcgcggtgcgcgcacgtggttccac
aaggaagaagacggcctgaacgagccgcagctcaagcaactgccggagctgacgtcggac
aatcagaagctgcgcacgtttatcgaactgcgcaaggatttgtcggcgatgtgggaccgt
tcgaacgcatcgcgcgagcaactcgtcacgcaattgcaggactggtgccatcgcgcggaa
gagagcggcatcaaagcgttgcaggatttcgcgctgcgtctgcgccgctacgcctga

DBGET integrated database retrieval system