KEGG   Burkholderia sp. YI23: BYI23_A005850Help
Entry
BYI23_A005850     CDS       T01711                                 

Gene name
holC
Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
byi  Burkholderia sp. YI23
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:byi00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:byi00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:byi03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:byi03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:byi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:664294..664710
Genome map
AA seq 138 aa AA seqDB search
MTRIDFHTNVGDPLAYACRLARKAYLSGKPLVVLAEPQRLAAFDEQLWTFQPLEFVPHCM
AKSPLAEDTPVVLTSNLDEAPHHHVLVNLGAPVSAQFARFERLVEIVGSDGDDLAAGRER
YRFYRDRGYAIETHNQGG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatcgactttcacactaacgtaggcgatccgctcgcgtacgcctgccgcctc
gcgcgcaaggcgtatctgagtggcaagccgctcgtcgtgctcgccgaaccgcagcgcctc
gccgcgttcgacgagcagttgtggaccttccagccgctcgaattcgtgccgcactgcatg
gcgaagagcccgctcgcggaggatacgccggtggtgctcacgtcgaatctcgacgaagcg
ccgcatcatcacgtgctcgtgaatctcggtgcgccggtgtccgcgcagttcgcgcgcttc
gagcgtctggttgagatcgtcggcagcgatggcgacgatctcgccgcgggccgcgagcgc
tatcgcttctatcgcgatcgcggctacgccatcgaaacgcacaatcagggcggttga

DBGET integrated database retrieval system