KEGG   Burkholderia sp. YI23: BYI23_A006300Help
Entry
BYI23_A006300     CDS       T01711                                 

Definition
hypothetical protein
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
byi  Burkholderia sp. YI23
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BYI23_A006300
Enzymes [BR:byi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BYI23_A006300
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BYI23_A006300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:714110..716200
Genome map
AA seq 696 aa AA seqDB search
MASERRATVVVTRPGGQSSALLALLTSAGFETLEFPLIDIAPIADDAPLRAALDELYLPP
DAPGRYALVVFVSPNAIDHAFGRLGAPWPADLPVAVVGPGSVAALAWQGVTAPSHRVISP
SAEDADPRFDSEALYTAIEAHFGTNGLEGKRVLIVRGDGGREWLAERLAEAGAKVEKASA
YRRVLPEPSMQKWERIHELLAGQPHAWLLTSSEGVRNLAELAHEHLTADEIARLKRAPLV
CPHPRIAEAARGAGFDRITVSGAGDERIAHSLEALFPAVETQREAEAHARASASSSVHSP
SAPAHANPATAPAHSTAYETAQSRMTDSNDSKKASPQPNVTPPLPPNTPFTPFEQQKHRG
GVGIVLLWLVVVILAVAAGAGAFVLNRKFDRADTQLSQRLAQADEQNADLRAKADQAASA
TTTLNTQIIQLQGKLADAEAHSQALQQQYQDLASNRDDWTVAEVEQILSSASQQLQLTGN
VQLALFALQSADERLASTTGPQVVAIRKAIAADIDKLKSAPTTDLTGLAIKLDTAIDQIG
QLPLSGEAPIERARAQAAEPADSASIAAATGEPRWKVLWRQITGGIGQQLSSLVSVRRID
NADAMLTSPDQGYFVRENVKLRLLSARLSLLSRSEPTLKSDLRAADAALARYFDASSKKV
QAVRDLVKQVDQASLAVAVPNLNASLAAVHQFKRGG
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgagcgccgcgccaccgtcgtcgtcacgcgtccgggcgggcagtcgtccgcg
ctgctcgcgcttcttacgagcgccggattcgagacgctggaattcccgctcatcgacatt
gctcccatcgccgacgatgcgccgttgcgcgccgcgctcgacgaactgtatctcccgccg
gacgcgcccgggcgttatgcgctcgtcgtgttcgtgtcgccgaatgcgatcgatcatgcg
ttcgggcggctcggcgcgccgtggcccgcggatctgccggtcgcggtcgtcggtcccggc
tcggtcgcggcgctcgcgtggcagggcgtgacagcgccgtcgcatcgcgtgatcagccca
tcggcggaagacgccgatccgcgtttcgattccgaagcgctctatacggccatcgaagcg
catttcggcacgaacggtctggaaggcaaacgcgtgctgatcgtgcgcggcgacggcggc
cgcgaatggctcgccgagcgcctcgcggaagccggcgcgaaggtcgagaaggcgagcgcg
taccggcgcgtgctgcccgagccgtccatgcagaagtgggagcgcatccacgaactgctc
gccgggcagccgcacgcatggctgctgacgagttccgaaggcgtgcgcaatctcgcggaa
ctcgcgcacgagcatctcaccgccgacgaaatcgcgcgcctgaaacgcgcgccgctcgtg
tgcccgcatccgcgcatcgccgaagccgcgcggggagcgggttttgataggattacggtg
tccggcgcgggcgacgaacgcatcgcacattcgctggaagcgctgttcccggccgtagaa
acgcaacgcgaagcggaggcccacgcacgagcgagcgcatcgagctcggttcattcccca
tccgcgccggcgcacgccaatccggccaccgcgccggctcactcaacggcctatgaaacg
gctcaatcacgcatgactgattcgaacgattccaagaaagcttcacctcagccgaacgtg
acaccgcccctgccgccgaacacgcctttcacgcctttcgagcagcagaagcatcgcggc
ggcgtgggcatcgtgttgttgtggctcgtggtcgtcattctggcggtggcggcgggcgcg
ggcgccttcgtgctgaaccgcaagttcgatcgtgccgacacgcaattgtcgcaacgtctc
gcccaggccgacgaacagaacgccgatctgcgcgcaaaagccgatcaggccgcgagcgcg
accaccacgctcaacacgcagatcatccagctgcaaggcaagctcgccgacgccgaagcg
cacagccaggcgctgcagcagcaatatcaggatctcgcgagcaatcgcgacgactggacg
gtcgccgaagtcgagcagattctgtcgagcgcgagccagcagttgcagttgaccggcaac
gtgcagctcgcgctctttgcgctgcaaagcgccgacgagcgcctcgcttcgaccaccggc
ccgcaagtggtggcgatccgcaaggcgatcgcggcggacatcgacaagctgaaatccgcg
cccacgaccgacctcaccggcctcgcgatcaagctcgatacggccatcgaccagatcggc
cagttgccgctgtccggcgaagcgccgatcgagcgcgcgcgtgcgcaggccgccgagccg
gccgatagcgcgtcgatcgcggcggcgaccggcgagccgcgctggaaggtgctgtggcgt
cagatcacgggcggcatcggccagcaactgtcgagcctcgtgtcggtgcggcgcatcgac
aacgccgacgccatgctcacatcgcccgatcaggggtatttcgtgcgcgagaacgtgaag
ctgcgcctgttgtccgcgcgtctgtcgctgctttcgcgcagcgagccgacgctcaagtcg
gacctgcgcgccgccgacgccgcccttgcgcgctacttcgatgcatcgtcgaaaaaggtt
caggccgtgcgcgatctcgtgaagcaggtcgatcaggcgtcgctcgccgtcgccgtgccg
aatctgaacgcgagccttgccgccgtccatcagttcaagcgaggcggatga

DBGET integrated database retrieval system