KEGG   Burkholderia sp. YI23: BYI23_A006650Help
Entry
BYI23_A006650     CDS       T01711                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
byi  Burkholderia sp. YI23
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BYI23_A006650
Enzymes [BR:byi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BYI23_A006650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:750107..750781
Genome map
AA seq 224 aa AA seqDB search
MPNTTHRSHSHYTGIYPGNLFMVVAPSGAGKSTLVNALLAEDKEILLSVSYTTREARSKE
TNGVQYHFVSVDEFMERRENGEFLESAEVHGNYYATSKLWIADQMKQGHDVLLEIDWQGA
QQVKKQFRNAVEIFILPPSLDALEDRLKKRGQDSEKVIVRRLLAAGSEMAHASEAEYVVI
NENFDRALAELRCLVAATRLRFTSQYARNTQLFVDLGIHSTPQS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgccgaataccacgcaccgctcgcacagccactatacgggcatctatcccggcaacctg
ttcatggtcgtcgcgccttcgggcgcgggcaagtccacgctcgtgaacgcgctgctcgcc
gaggataaggagattctgctgtcggtttcgtatacgacgcgcgaagcgcgttcgaaggaa
accaacggcgtgcagtatcacttcgtgtcagtagacgaattcatggagcggcgcgaaaac
ggcgagtttctggaaagcgccgaagtgcacggcaactactatgcgacctcgaagctgtgg
atcgccgatcagatgaagcagggccacgacgtgctgctcgaaatcgactggcagggcgcg
cagcaggtgaagaagcagtttcgcaacgcggtggagattttcattctgccgccgtcgctc
gacgcgctcgaagaccgcctcaagaaacgcggccaggattccgaaaaagtgatcgtgcgg
cggctgctcgcggccggcagcgaaatggcgcatgcatcggaagcggagtatgtggtgatc
aacgaaaacttcgatcgcgcgctcgcggaactgcgttgcctcgtggccgcgacgcgcctg
cgcttcacgtcgcaatacgcgcgcaatacgcagcttttcgtggatctcggcattcattcg
acgccgcaatcctga

DBGET integrated database retrieval system