KEGG   Burkholderia sp. YI23: BYI23_A007240Help
Entry
BYI23_A007240     CDS       T01711                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
byi  Burkholderia sp. YI23
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BYI23_A007240
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BYI23_A007240
   00052 Galactose metabolism
    BYI23_A007240
   00500 Starch and sucrose metabolism
    BYI23_A007240
   00520 Amino sugar and nucleotide sugar metabolism
    BYI23_A007240
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BYI23_A007240
   00524 Butirosin and neomycin biosynthesis
    BYI23_A007240
Enzymes [BR:byi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BYI23_A007240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:816355..818265
Genome map
AA seq 636 aa AA seqDB search
MSTGVHKAAAQHADGPRLLADIGGTNARFALETAPGEIGQIRVYPGADYPGIAEVMQQYL
KDTKVGRVNHAAIAIANPVDGDHVKMTNHDWSFSIEATRRALGFDTLLVVNDFTALAMAL
PGLTDAQREQIGGGARRQNSVIGLLGPGTGLGVSGLIPADDRWIALGSEGGHATFSPFDE
REDLVMRFARRKFPHVSFERVCAGQGLELIYRALAERDKVSVADDFTAADVTHRALQGEA
LALETVNCFCAILGTFAGNIAVTLGALGGIYIGGGIVLKLGELFHKSPFRERFEAKGRFQ
QYLSGIPTYIITAEYPAFLGVSAILSEQLSNRANSGSSAVFERIRQMRDALTPAERRVAD
LALNHPRSIINDPIIDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPVSHS
QVHLGDTATDFGAKVLDNTVSAILQLREHLNFENVERAIDILNGARRIEFYGLGNSNIVA
QDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLEVAMQQGA
TVIAITSSNTPLAKRATVALETDHIEIRESQLSMISRILHLVIIDILAVGVAIRRAAPKP
GAKISEAVAKARQSGDDDAAAVLDWLSHGASGMARD
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgtgcataaggcagcggctcagcacgccgacggaccgaggctactcgcc
gacatcggcggcaccaacgcgcgtttcgcgctggaaacggcgcccggcgagatcgggcag
atccgtgtctatccgggcgccgactaccccggcatcgcggaggtgatgcagcagtatctg
aaggacaccaaggtcgggcgcgtgaatcacgcggcgatcgcaatcgccaatccggtcgac
ggcgatcacgtgaagatgaccaatcacgactggagcttctcgatcgaggcgacgcgccgc
gcgctcggcttcgatacgctgctcgtcgtcaatgatttcaccgcgctcgcgatggcgctg
cccggcctgaccgatgcgcagcgcgagcagatcggcggcggcgcgcggcggcagaacagc
gtgatcggcctgctcggaccgggcacggggctgggcgtctcgggcctcattcccgccgac
gaccgctggatcgcgctcggcagcgaaggcggtcacgccacgttctcgccgttcgacgag
cgcgaagacctcgtgatgcgcttcgcgcgccgcaagtttccgcacgtctcgttcgagcgc
gtatgcgcggggcaggggctggagctgatctaccgggccctggcggaacgcgacaaagtc
tccgtcgcggacgatttcaccgccgccgacgtgacgcaccgcgcactgcaaggcgaagcg
ctcgcgctcgaaaccgtgaactgcttctgcgcgattctcggcacgttcgcgggcaatatc
gcggtgacgctgggcgcgctgggcggcatttatatcggcggcggcatcgtgctcaagctc
ggcgagctgttccacaagtcgccgtttcgcgagcgcttcgaggcgaaagggcgctttcag
cagtatttgtcgggcattccgacgtacatcatcacggcggaatatccggcgtttctcggc
gtctccgcgattctgtcggagcagttgtcgaaccgcgcgaacagcggctcgtcggcggtg
ttcgagcgaattcgccagatgcgcgacgcgttgacgcccgccgagcggcgcgtcgcggat
ctcgcgctgaatcatccgcgctcgatcatcaacgatccgatcatcgacatcgcgcgcaag
gccgacgtgagccagcccaccgtgatccgcttttgccgctcgctcggctgtcagggcttg
tccgacttcaagctgaagctcgcgaccggcctgacgggcacgattccggtgagccacagc
caggtgcatctgggcgacacggccaccgacttcggcgcgaaagtgctggacaacaccgtg
tccgcgatcctgcagttgcgcgagcatctgaatttcgagaacgtcgagcgcgcgatcgat
attctcaacggcgcgcggcgcatcgagttttacggactcggcaattcgaacatcgtcgcg
caggacgcgcattacaagttcttccgcttcggcatcccgacgatcgcttacggcgacctg
tacatgcaggcggcctccgccgcgctgctcggcaagggcgacgtgatcgtggcggtgtcg
aagtcggggcgcgcgccggaactgctgcgcgtgctcgaagtggcgatgcagcagggcgcg
acggttatcgcgatcacgtcgagcaacacgccgcttgccaagcgcgcgaccgtagcgctc
gagacggatcacatcgagatccgcgagtcgcagctttcgatgatctcgcgcattctgcat
ctcgtgatcatcgatatcctcgcggtcggcgtggcgatccgccgtgcggcgccgaagccg
ggcgcgaagatcagcgaggcggtcgcgaaggcgcgtcaatccggcgacgatgacgccgca
gcggtgctcgactggctgagccacggcgcatcgggcatggcgcgggattga

DBGET integrated database retrieval system