KEGG   Burkholderia sp. YI23: BYI23_A007250Help
Entry
BYI23_A007250     CDS       T01711                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
byi  Burkholderia sp. YI23
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(818298..819062)
Genome map
AA seq 254 aa AA seqDB search
MSANRTAALLIHGLGGTRFDLGSLHKTLKRGGIDTHSLTLPGHGGRPHDLVGVRAEDWLD
AVRKKYREVSQDYETVHVIGMCMGALLAIALCAAEEHRRGKLIALAPPVFLDGWATPWYA
AARHALYRVPLLPARMRIAENEPYGVKNALVRSVVKAKFERGDNFHYRWVPLACLREVDR
LRRKVKRSAHAIGCATLVMHAREDELTSLRSATFLRERIGDSELVVLENSYHLICVDNDR
EVVKRNVLQFLDLA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgaaccgcaccgccgcgctgctcatccacggcctcggcggcacgcggttcgac
ctgggctcgctgcacaaaacgctgaaacgcggggggatcgacacgcattcgctcacgctg
ccggggcacggcggccggccgcacgatctcgtcggcgtgcgcgcagaggattggctcgac
gccgtgcgcaagaagtaccgcgaggtctcgcaggactacgagacggtgcatgtcatcggc
atgtgcatgggcgcgctgctcgcgatcgcgctgtgcgcggcggaagagcaccggcggggc
aagctgatcgcgctcgccccgccggttttcctcgacggctgggcgacgccgtggtacgcg
gccgcgcgtcacgcgctctaccgtgtgccgttgctgcccgcgcggatgcgtatcgccgaa
aacgagccctatggcgtcaagaacgcgctggtgcgctcggtcgtgaaggcgaagttcgaa
cgcggcgacaatttccactaccgctgggtgccgctcgcgtgtctgcgcgaagtggaccgc
ctgcgccgcaaggtgaagcgttcagcgcacgcgatcggctgcgccacgctcgtcatgcat
gcgcgcgaggacgaactgacgagcctgcgctcggcgaccttcctgcgcgagcgcatcggc
gattcggaactcgtggtgctggagaacagctatcacctgatttgcgtcgataacgaccgc
gaggtcgtcaagcgcaacgtgttgcagtttctggatctcgcgtaa

DBGET integrated database retrieval system