KEGG   Burkholderia sp. YI23: BYI23_A010240Help
Entry
BYI23_A010240     CDS       T01711                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
byi  Burkholderia sp. YI23
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BYI23_A010240
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BYI23_A010240
   00630 Glyoxylate and dicarboxylate metabolism
    BYI23_A010240
Enzymes [BR:byi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BYI23_A010240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1157467..1159077)
Genome map
AA seq 536 aa AA seqDB search
MTHPSNSLSLPKGMAIPADIKPGYEAILTPEALEFVAALHRQFEPRRQQLLAARVERTKR
LDAGERPGFLEETKSIREGDWKVAPLPKDLQCRRVEITGPVERKMIINALNSGADSYMTD
FEDSNAPNWDNQIVGQINLKEAVRRTISLEQNGKSYKLNDTVATLIVRPRGWHLDEKHVS
VDGQRVSGGIFDFALFLFHNAKELIARGSGPYFYLPKMESHLEARLWNDIFVAAQEAVGI
PRGTIRATVLVETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDTDFCLADR
AKITMTAPFMRAYALELLRTCHKRNAPAIGGMSALIPIKNDPAANDRAMSGVRSDKARDA
TDGYDGGWVAHPGLVPLAMEEFVKVLGDRPNQIDKQRTDVQVTAHDLLDFRPEEPITEAG
LRNNVNVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLDDGRKVTA
AMVREITVDELEKVKQSVKASGADTKPYDRAAKIFEDMSTSADFTEFLTLPLYEAI
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatccctccaactcgctttcgcttccgaaaggcatggcaatccccgccgacatc
aagcccggctacgaggccattctgacgcccgaggcgctcgaattcgtcgccgcgctgcat
cgccagttcgagccgcgccgccagcaattgctcgcggcgcgcgtcgagcgcacgaagcgt
ctcgatgccggcgaacgcccgggctttctcgaagaaacgaagtcgatccgcgaaggcgac
tggaaagtcgcgccgctgccgaaggatctgcaatgccgccgcgtcgagatcaccggccct
gtcgagcgcaagatgatcatcaacgcgctcaactccggcgcggattcgtacatgaccgac
ttcgaggattcgaacgcgccgaactgggacaaccagatcgtcggccagatcaacctgaag
gaagcggtgcgccgcacgatttcgctggaacagaatggcaagtcgtacaagctcaacgac
acggtcgcgacgctgatcgtgcgcccgcgcggctggcatctcgatgaaaagcacgtgagc
gtcgacggccagcgcgtctcgggcggcattttcgatttcgcgctctttctctttcataac
gcgaaggaactgatcgcgcgcggcagcggcccgtacttctatctgccgaagatggaaagc
catctcgaagcgcgcctgtggaacgatatcttcgtcgcggcacaggaggccgtgggcatt
ccgcgcggcacgattcgcgcgacggtgctcgtcgaaacgattctcgccgcgttcgagatg
gacgagattctctatgaactgcgcgagcacagttccggcctgaacgcgggccgctgggac
tacatcttctcggcgatcaagaagttcaaaaacgacacggacttttgcctcgcggaccgc
gcgaagatcaccatgaccgcgccgttcatgcgcgcctacgcgctcgaactgctgagaacc
tgccacaagcgcaatgcgccggcaatcggcggcatgtccgcgctgattccgatcaagaac
gatcccgccgcgaacgaccgcgccatgagcggtgtgcgctccgacaaggcccgcgacgcc
accgacggctacgacggcggctgggtcgcgcatcccggtctcgtgccgctcgcgatggaa
gaattcgtgaaggtgctcggcgacaggccgaatcagatcgacaagcagcgcaccgacgtg
caagtgaccgcgcacgacctgctcgacttccgcccggaagagccgatcaccgaagcggga
ctgcgcaacaacgtgaacgtcggcatccactatctcggttcgtggctcgcgggcaatggc
tgcgtgccgatccacaatctgatggaagacgccgcgaccgccgaaatctcgcgctcgcaa
gtgtggcagtggatccgctcgccgaagggcaagctcgacgacggccgcaaggtcacggcc
gcgatggtgcgcgagatcaccgtcgacgaactggagaaggtgaagcaaagcgtcaaggcg
tcgggcgccgacacgaagccgtacgatcgcgccgcgaagatcttcgaggacatgtcgacc
tcggcggatttcaccgagtttctgacgctgccgctttacgaagcgatctga

DBGET integrated database retrieval system