KEGG   Burkholderia sp. YI23: BYI23_A010280Help
Entry
BYI23_A010280     CDS       T01711                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00630  Glyoxylate and dicarboxylate metabolism
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01120  Microbial metabolism in diverse environments
byi01200  Carbon metabolism
Module
byi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BYI23_A010280
Enzymes [BR:byi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BYI23_A010280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AET88866
UniProt: G8M807
Position
1:complement(1161571..1162878)
Genome map
AA seq 435 aa AA seqDB search
MTSRQQQAQQLQQQWEADPRWKGIKRGYSAEDVVRLRGSVHQEHSLARRGAEKLWESINE
EPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVK
RINNTLTRADQIQWSEGKNPGDEGYIDYFAPIVADAEAGFGGVLNAFELMKAMIEAGAAG
VHFEDQLASVKKCGHMGGKVLVPTRENVAKLTAARLAADVCGVPTVLVARTDAEAADLVT
SDIDDNDKPFLTGERTVEGFFRTKPGLEQAVSRGLAYAPYADLVWCETGKPDLEYAKKFA
EAIHKQFPDKMLSYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHALNYSM
FNLAHGYARSQMSAFVELQQAEFAAADKGFTAVKHQREVGTGYFDAVTQTVERDASTTAL
HGSTEDEQFFDKKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacgtcaacaacaagctcagcaactccagcagcaatgggaagccgatccgcgc
tggaaaggcatcaagcgcggctactcggcggaggacgtcgtgcgtctgcgcggctcggtg
catcaggagcactcgctcgcacgccgcggcgccgaaaagctgtgggagtcgatcaacgag
gagcccttcgtcaacgcgctcggcgcgctgaccggcaatcaggcgatgcagcaggtcaag
gccggcctcaaggcgatttatctgtcgggctggcaggtggctggggacgccaacgtcgcg
ggcgaaatgtatcccgaccagtcgctgtatccggcgaattcggtgccgctcgtcgtgaag
cgcatcaacaatacgctcacgcgcgccgatcagattcagtggtcggaaggcaagaatccg
ggcgacgaagggtatatcgactacttcgcgccgatcgtggccgatgccgaagccggtttc
ggcggcgtgctgaacgccttcgaactgatgaaagcgatgatcgaagccggcgccgcgggc
gtgcacttcgaagaccagctcgcctcggtcaagaagtgcggccacatgggcggcaaggtg
ctcgtgccgacgcgcgaaaacgtcgcgaagctcacggccgcgcgtctcgcggcggacgtg
tgcggcgtgccgaccgtgctcgtcgcccgcaccgacgccgaagccgccgatctcgtcacc
tccgacatcgacgacaacgacaagccgttcctcaccggcgagcgcaccgtggaaggcttc
ttccgcaccaagccgggcctggaacaggcggtgtcgcgcggcctcgcctacgcgccctat
gcggatctcgtgtggtgcgaaacgggcaagccggatctggaatacgcgaagaagttcgcc
gaggcgatccacaagcagttcccggacaagatgctgtcctacaactgctcgccgtcgttc
aactggaagaagaatctggacgacgcgaccatcgccaagttccagcgcgagttgggcgcg
atgggctacaagttccagttcatcacgctggccggcttccacgcgctgaactactcgatg
ttcaacctcgcgcacggctacgcgcgttcgcagatgagcgcgttcgtcgagttgcagcag
gccgagtttgccgccgccgacaagggcttcacggcggtcaagcatcagcgcgaagtgggc
acgggctatttcgatgcggtcacgcagacggtggagcgcgacgcatcgacgaccgcgctg
cacggctcgaccgaagacgagcagttcttcgacaagaaggtggcttga

DBGET integrated database retrieval system