KEGG   Burkholderia sp. YI23: BYI23_A010280Help
Entry
BYI23_A010280     CDS       T01711                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
byi  Burkholderia sp. YI23
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:byi01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:byi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1161571..1162878)
Genome map
AA seq 435 aa AA seqDB search
MTSRQQQAQQLQQQWEADPRWKGIKRGYSAEDVVRLRGSVHQEHSLARRGAEKLWESINE
EPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVK
RINNTLTRADQIQWSEGKNPGDEGYIDYFAPIVADAEAGFGGVLNAFELMKAMIEAGAAG
VHFEDQLASVKKCGHMGGKVLVPTRENVAKLTAARLAADVCGVPTVLVARTDAEAADLVT
SDIDDNDKPFLTGERTVEGFFRTKPGLEQAVSRGLAYAPYADLVWCETGKPDLEYAKKFA
EAIHKQFPDKMLSYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHALNYSM
FNLAHGYARSQMSAFVELQQAEFAAADKGFTAVKHQREVGTGYFDAVTQTVERDASTTAL
HGSTEDEQFFDKKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacgtcaacaacaagctcagcaactccagcagcaatgggaagccgatccgcgc
tggaaaggcatcaagcgcggctactcggcggaggacgtcgtgcgtctgcgcggctcggtg
catcaggagcactcgctcgcacgccgcggcgccgaaaagctgtgggagtcgatcaacgag
gagcccttcgtcaacgcgctcggcgcgctgaccggcaatcaggcgatgcagcaggtcaag
gccggcctcaaggcgatttatctgtcgggctggcaggtggctggggacgccaacgtcgcg
ggcgaaatgtatcccgaccagtcgctgtatccggcgaattcggtgccgctcgtcgtgaag
cgcatcaacaatacgctcacgcgcgccgatcagattcagtggtcggaaggcaagaatccg
ggcgacgaagggtatatcgactacttcgcgccgatcgtggccgatgccgaagccggtttc
ggcggcgtgctgaacgccttcgaactgatgaaagcgatgatcgaagccggcgccgcgggc
gtgcacttcgaagaccagctcgcctcggtcaagaagtgcggccacatgggcggcaaggtg
ctcgtgccgacgcgcgaaaacgtcgcgaagctcacggccgcgcgtctcgcggcggacgtg
tgcggcgtgccgaccgtgctcgtcgcccgcaccgacgccgaagccgccgatctcgtcacc
tccgacatcgacgacaacgacaagccgttcctcaccggcgagcgcaccgtggaaggcttc
ttccgcaccaagccgggcctggaacaggcggtgtcgcgcggcctcgcctacgcgccctat
gcggatctcgtgtggtgcgaaacgggcaagccggatctggaatacgcgaagaagttcgcc
gaggcgatccacaagcagttcccggacaagatgctgtcctacaactgctcgccgtcgttc
aactggaagaagaatctggacgacgcgaccatcgccaagttccagcgcgagttgggcgcg
atgggctacaagttccagttcatcacgctggccggcttccacgcgctgaactactcgatg
ttcaacctcgcgcacggctacgcgcgttcgcagatgagcgcgttcgtcgagttgcagcag
gccgagtttgccgccgccgacaagggcttcacggcggtcaagcatcagcgcgaagtgggc
acgggctatttcgatgcggtcacgcagacggtggagcgcgacgcatcgacgaccgcgctg
cacggctcgaccgaagacgagcagttcttcgacaagaaggtggcttga

DBGET integrated database retrieval system