KEGG   Burkholderia sp. YI23: BYI23_A010440Help
Entry
BYI23_A010440     CDS       T01711                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
byi  Burkholderia sp. YI23
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:byi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:byi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1178983..1179465
Genome map
AA seq 160 aa AA seqDB search
MSNDIYGFSAETLDGATVGLDTYRDKVLLIVNTASECGFTPQYKGLQEIYQQFATRGFAV
LGFPCNQFGKQEPGDAQQIGSFCEKNFGVTFPMFAKIEVNGANAHPLYKYLKDKEPGLLG
IEAIKWNFTKFLIDRKGNVVKRYAPQTKPEAIADEIEKLL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgacatctacggtttttcggccgaaacactcgacggcgcgaccgtcggcctc
gacacctaccgcgacaaagtgctgctgatcgtgaatacggcgagcgaatgcggtttcacg
ccgcaatacaagggcttgcaggagatctaccagcaattcgccacgcgcggtttcgccgtg
ctcggctttccgtgcaaccagttcggcaagcaggaaccgggcgacgcgcagcagatcggc
agcttttgcgaaaagaacttcggcgtcacgtttccgatgttcgcgaagatcgaagtgaac
ggcgcgaatgcgcatccgctctacaagtatctgaaggacaaggagccggggctgctcggc
atcgaggcgatcaagtggaatttcacgaagtttctcatcgatcgcaagggcaatgtcgtg
aaacgctacgcgccgcagaccaagcctgaagcgatcgccgacgagatcgaaaagctcctc
tga

DBGET integrated database retrieval system