KEGG   Burkholderia sp. YI23: BYI23_A010650Help
Entry
BYI23_A010650     CDS       T01711                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
byi  Burkholderia sp. YI23
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BYI23_A010650
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BYI23_A010650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1206201..1207418
Genome map
AA seq 405 aa AA seqDB search
MQKRLTLLGSTGSIGDSTLDVVARHPDRFSVYALSAHRNGEKLVAQCLKFQPEVAVVGDA
ETAARVAQALRAAGCKTEVTHGPDALVEVARADSCDTVVAAIVGAAGLAPTLAAARAGKR
ILLANKEALVMSGQIFMDAVRDNGAILLPVDSEHNAVFQCLPPCADKEAKLHGGVSKIIL
TASGGPFRTREPATLVNVTPEEAVKHPNWAMGRKISVDSATMMNKGLEVIEAHWLFDLPG
SRIEVLIHPQSVIHSMVSYADGSVLAQLGNPDMRTPIAHALAYPERVDSGVAALDLAQIA
SLTFEKPDFSRFPCLALAIQALEAGGIASAALNAANEIAVEAFLERRIGFMAIGEVVERV
LSALPNTSAATLADVLAADANARRLASGFVAELTASAPGAEPIAH
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacgtctcacattgctcggctccacgggctcgatcggcgatagcacgctcgac
gtcgtggcgcggcacccggaccgtttctcggtctacgcgctcagcgcgcatcgcaacggc
gagaagctcgtcgcccaatgtctgaagtttcagcccgaagtggccgtcgtcggcgatgcc
gaaaccgccgcgcgcgtcgctcaggcattgcgcgccgcgggctgcaagacggaagtgacg
cacgggcccgacgcgctcgtcgaggtcgcacgcgcggattcgtgcgatacggtcgtcgcg
gccatcgtcggcgcggcgggccttgcgcccacgctcgccgccgcgcgcgccggcaagcgc
atcctgcttgcgaacaaggaagcgctcgtgatgtccggccagatcttcatggacgcggtg
cgcgataacggcgcgattctgctgccggtcgacagcgagcacaacgcggtatttcagtgt
ctgccgccttgcgcggacaaagaggcgaagctgcacggcggcgtctcgaagatcatcctc
acggcatccggcggcccgttccgtacgcgcgagccggccacgctcgtgaacgtcacgccc
gaagaggccgtgaagcacccgaactgggcgatgggccgcaagatttccgtcgattccgcg
acgatgatgaacaagggcctcgaagtcatcgaggcgcactggctcttcgatctgcccgga
tcgcgtatcgaggtgctgatccatccgcaaagcgtgattcactcgatggtgtcctacgcg
gacggctcggtgctcgcgcagctcggcaatcccgatatgcgcacgccgatcgcgcatgcg
ctggcgtatcctgaacgtgtggactcgggcgtcgcggcgctcgatctcgcgcagatcgcg
tcccttacgttcgagaagcccgatttctcgcgctttccgtgtctcgcgctcgccattcag
gcgctggaggcgggcggcatcgcgagcgccgcgctcaatgcggcgaacgaaatcgccgtg
gaggcgttcctcgagcgccgcatcggcttcatggcgatcggcgaagtggtggagcgcgtg
ctgagcgccttgccgaacacgagcgccgccacgcttgccgacgtcctcgccgccgatgcg
aacgcgcgccgtctcgcatccggtttcgtcgcagagctcaccgcgagcgcgccaggcgcc
gaacccatcgcccattga

DBGET integrated database retrieval system