KEGG   Burkholderia sp. YI23: BYI23_A011870Help
Entry
BYI23_A011870     CDS       T01711                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
byi  Burkholderia sp. YI23
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BYI23_A011870
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BYI23_A011870
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BYI23_A011870
Enzymes [BR:byi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BYI23_A011870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1328058..1329503
Genome map
AA seq 481 aa AA seqDB search
MNYISTRGAGQNERHTFSDILLGGLAKDGGLYLPNDYPKVSAAELATWRTLSYADLAFEV
LSKFSDDIPADDLRSLTRKTYTAQVYSNVRHEESAVQITPLKTLGEENGTTLSLLELSNG
PTLAFKDMAMQLLGNLFEYALARHGEELNILGATSGDTGSAAEYAMRGKTGVRVFMLSPH
GKMSAFQTAQMFSLQDPNIFNLAVEGNFDNCQDIVKAVSNDHAYKAKHKIGTVNSINWAR
VVAQVVYYFKGYFAATASNEERVSFTVPSGNFGNVCAGHIARMMGLPIDQLVVATNENDV
LDEFFKTGVYRVRGAAETYHTTSPSMDISKASNFERFVYDLLGRDPARVLQLFRDVEEQG
GFDLAASGDFARVKEFGFVSGKSGHDDRVKTIRDVFDRYQTMIDTHTADGVKVARENLKP
GVPMIVLETAQPIKFGETIREALDCEPERPSAFVGLEKLPQRFDIVPADASVVKAFIAER
T
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaactacatctcgacgcgcggcgccggccagaacgagcgccacacgttctcggacatt
ctgctgggcggcctcgcgaaagacggcggtctgtatctgccgaacgactacccgaaggtc
agcgccgccgaactcgcgacatggcgcacgctgtcgtacgcggatctcgcgttcgaagtg
ctgtccaaattcagcgacgacattcccgccgacgacctgcgctcgctcacgcgcaagacc
tacacggcgcaggtgtacagcaatgtgcgccatgaagaaagcgcggtgcagattacgccg
ttgaagacgctcggcgaggaaaacggcacgacgctgtcgctgctggaattgtcgaacggc
ccgacgctcgccttcaaggacatggcgatgcaactgctcggcaatctgttcgagtacgca
ttggcccggcacggcgaagagctgaacattctcggcgcgacgtcgggcgataccggcagc
gcggcggaatacgcgatgcgcggcaagaccggcgtgcgcgtgttcatgctgtcgccgcac
gggaagatgagcgcgttccagaccgcgcagatgttctcgctgcaagacccgaacatcttc
aatctggccgtcgagggcaatttcgacaactgccaggacatcgtcaaggccgtgtcgaac
gatcatgcctacaaggcgaagcacaagatcggcaccgtcaattcgatcaactgggcgcgc
gtcgtcgcgcaggtcgtgtactacttcaagggctacttcgcggcgacggcgagcaacgag
gagcgcgtgtcgttcacggtgccctcgggcaacttcggcaatgtgtgtgctgggcacatc
gcccgcatgatgggcctgccgatcgatcagctcgtcgtcgcgaccaatgaaaacgacgtg
ctcgacgagttcttcaagacgggcgtgtaccgcgtgcgcggcgcggccgagacgtatcac
acgaccagcccgagcatggacatttcgaaggcgtcgaacttcgagcgcttcgtgtacgac
ttgctgggccgcgacccggcgcgcgtgctgcagcttttccgcgacgtggaagaacagggc
ggctttgatctcgcggcgagcggcgacttcgcgcgcgtgaaggaattcggcttcgtgtcg
ggcaagagtggccacgacgatcgcgtgaagacgattcgcgacgtgttcgaccggtatcag
acgatgatcgacacccataccgccgacggcgtgaaggtcgcgcgcgagaacctgaagccc
ggcgtgccgatgatcgtcctggaaaccgcgcagccgatcaagttcggcgagacgatccgc
gaggcgctcgattgcgagccggaacggccgtcggcgttcgtgggacttgaaaaactgcca
caaaggttcgatatcgttcccgcggatgcgagcgtggtgaaggcgttcatcgccgaacga
acgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system