KEGG   Burkholderia sp. YI23: BYI23_A011870Help
Entry
BYI23_A011870     CDS       T01711                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
byi  Burkholderia sp. YI23
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BYI23_A011870
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BYI23_A011870
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BYI23_A011870
Enzymes [BR:byi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BYI23_A011870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1328058..1329503
Genome map
AA seq 481 aa AA seqDB search
MNYISTRGAGQNERHTFSDILLGGLAKDGGLYLPNDYPKVSAAELATWRTLSYADLAFEV
LSKFSDDIPADDLRSLTRKTYTAQVYSNVRHEESAVQITPLKTLGEENGTTLSLLELSNG
PTLAFKDMAMQLLGNLFEYALARHGEELNILGATSGDTGSAAEYAMRGKTGVRVFMLSPH
GKMSAFQTAQMFSLQDPNIFNLAVEGNFDNCQDIVKAVSNDHAYKAKHKIGTVNSINWAR
VVAQVVYYFKGYFAATASNEERVSFTVPSGNFGNVCAGHIARMMGLPIDQLVVATNENDV
LDEFFKTGVYRVRGAAETYHTTSPSMDISKASNFERFVYDLLGRDPARVLQLFRDVEEQG
GFDLAASGDFARVKEFGFVSGKSGHDDRVKTIRDVFDRYQTMIDTHTADGVKVARENLKP
GVPMIVLETAQPIKFGETIREALDCEPERPSAFVGLEKLPQRFDIVPADASVVKAFIAER
T
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaactacatctcgacgcgcggcgccggccagaacgagcgccacacgttctcggacatt
ctgctgggcggcctcgcgaaagacggcggtctgtatctgccgaacgactacccgaaggtc
agcgccgccgaactcgcgacatggcgcacgctgtcgtacgcggatctcgcgttcgaagtg
ctgtccaaattcagcgacgacattcccgccgacgacctgcgctcgctcacgcgcaagacc
tacacggcgcaggtgtacagcaatgtgcgccatgaagaaagcgcggtgcagattacgccg
ttgaagacgctcggcgaggaaaacggcacgacgctgtcgctgctggaattgtcgaacggc
ccgacgctcgccttcaaggacatggcgatgcaactgctcggcaatctgttcgagtacgca
ttggcccggcacggcgaagagctgaacattctcggcgcgacgtcgggcgataccggcagc
gcggcggaatacgcgatgcgcggcaagaccggcgtgcgcgtgttcatgctgtcgccgcac
gggaagatgagcgcgttccagaccgcgcagatgttctcgctgcaagacccgaacatcttc
aatctggccgtcgagggcaatttcgacaactgccaggacatcgtcaaggccgtgtcgaac
gatcatgcctacaaggcgaagcacaagatcggcaccgtcaattcgatcaactgggcgcgc
gtcgtcgcgcaggtcgtgtactacttcaagggctacttcgcggcgacggcgagcaacgag
gagcgcgtgtcgttcacggtgccctcgggcaacttcggcaatgtgtgtgctgggcacatc
gcccgcatgatgggcctgccgatcgatcagctcgtcgtcgcgaccaatgaaaacgacgtg
ctcgacgagttcttcaagacgggcgtgtaccgcgtgcgcggcgcggccgagacgtatcac
acgaccagcccgagcatggacatttcgaaggcgtcgaacttcgagcgcttcgtgtacgac
ttgctgggccgcgacccggcgcgcgtgctgcagcttttccgcgacgtggaagaacagggc
ggctttgatctcgcggcgagcggcgacttcgcgcgcgtgaaggaattcggcttcgtgtcg
ggcaagagtggccacgacgatcgcgtgaagacgattcgcgacgtgttcgaccggtatcag
acgatgatcgacacccataccgccgacggcgtgaaggtcgcgcgcgagaacctgaagccc
ggcgtgccgatgatcgtcctggaaaccgcgcagccgatcaagttcggcgagacgatccgc
gaggcgctcgattgcgagccggaacggccgtcggcgttcgtgggacttgaaaaactgcca
caaaggttcgatatcgttcccgcggatgcgagcgtggtgaaggcgttcatcgccgaacga
acgtag

DBGET integrated database retrieval system