KEGG   Burkholderia sp. YI23: BYI23_A012200Help
Entry
BYI23_A012200     CDS       T01711                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
byi  Burkholderia sp. YI23
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BYI23_A012200
Enzymes [BR:byi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BYI23_A012200
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BYI23_A012200
Lipid biosynthesis proteins [BR:byi01004]
 Fatty acid synthase
  Component type
   BYI23_A012200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1369496..1370191)
Genome map
AA seq 231 aa AA seqDB search
MTGSILFCMDTLKKSLRGFVPAIALVATGTAPAHAAEVQAATQPKPAIVVLGDSLSAEYG
LPRDTGWVNLLRERLAKERFDYSVANSSISGDTTSGGRARLTAVLSRIKPAVVIVELGAN
DALRGVPLATTETNLRGIVDASQAAHAKVLLIGMYVPPNYGPDYTQKFHAVYERIAKERN
VPLVPFLLAGIADKPAMFQADQIHPTVQAQPLLLDNVWPTLKPLLGAAAVH
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaccggttcgatattgttttgcatggacactttgaaaaagagcttgcgcggcttcgtg
cccgcgattgcgctggtggcgacgggcaccgcgcccgcgcacgccgcggaagtgcaggcg
gccacccagccgaaacccgcgatcgtcgtgctgggcgatagcctctcggccgaatacggc
ttgccgcgcgataccggctgggtgaatctcttgcgcgagcggctggcgaaggagcgtttc
gattatagcgtcgccaattcgagcatcagcggcgacaccacgagcggcgggcgcgcgcgg
ctgaccgcggtgctttcgcgcatcaagcccgccgtggtgatcgtcgagctcggcgcgaac
gatgcgctgcgtggcgtgccgctcgcgaccacggagacgaacctgcgcggtatcgtcgat
gcatcgcaagccgcgcatgcgaaggttttactcatcggcatgtacgttccacccaattac
ggcccggactacacgcaaaagttccacgcggtctacgagcgtatcgcgaaggagcgcaac
gtgccgctcgtgcccttcctgcttgccggtattgctgacaaacctgccatgtttcaggcc
gatcagatccatccgacggtgcaggcccagcctttgctgctggataacgtctggccaacc
ttgaaacccttgctgggcgccgccgccgttcattga

DBGET integrated database retrieval system