KEGG   Burkholderia sp. YI23: BYI23_A012280Help
Entry
BYI23_A012280     CDS       T01711                                 

Definition
chitinase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
byi  Burkholderia sp. YI23
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BYI23_A012280
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BYI23_A012280
Enzymes [BR:byi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BYI23_A012280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1381873..1384305
Genome map
AA seq 810 aa AA seqDB search
MLTACGDSSDSDSANLSPVARAAVLGDNLMVRGAIDTNDAAKSGTDCADLGADWASCARG
KLILENAGGRSIAAGGWTLYVHSIRRILMVEHPAFAWKHITGDLYALTPRAGAFALGAGE
RIEVPFVGEYWYQRYSDLLPRAYVVADGNAAPAILKHNDTDDETRYVDRIPPSADAAATF
AATPAQVQRARAEAALPSAQQVAARALPAVLRSTPNEGVAQIGGIELSMSGLTSSQRAAL
EARAATLGLTGAALRVNGQIAGGSLPADIARAGGYRLTIAQGGANIDAFDVAGLFYGVQT
LLSLTPAGGGNVPAMTIEDAPRFTHRGMHVDVARNFRQPATPRRLIDQMGAYKLNRLHLH
LSDDEGWRIEIPGLPELTDIGAKRCHDLTETRCLVPQLASGPDNRSGGGYLSRADYVALV
RYAADRFVEIIPEIDMPGHARAAVVSMEARFQRLSAKGDKTGANAYRLLDPADTSNATTV
QFYDRRSFINPCGDGAQRFASKVIGEIAAMHREAGAPLSVWHFGGDEAKNILLGAGFQPL
DGTDPGKGRVNLAAQDKPWGRSPQCAALIASGKAASVDELPSMFARQVSQIVRNNGIGTM
AAWQDGIKHAKGPQDFATSNTMVTMWDTIFWGASDTVQALSGQGYKTVLALPDYLYFDFP
YAFDQRERGYYWGSHGTDSFKTFSLAPDNLPQNAEIMADRDGKPFEVTSAGPAPHIEGIQ
GQAWAEVMRTDPQFEYMVYPRLLALAERAWHRAEWERPYRDGERYKLGDTDKVDKAALAR
DWAGFASVVQNRELAKLKRAGAVMREGAGS
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
ctgctcacggcgtgcggcgacagttccgattcggattcggcgaatctgtcgccggtagcg
cgcgcggccgtgctcggcgacaacctgatggtgcgcggcgcaatcgacaccaacgatgcc
gcgaaatccggcacggactgcgcggacctcggcgcggactgggcgagttgcgcgcgcggc
aagctgattctggaaaacgccggcggacgcagcatcgccgcgggcggctggacgctgtac
gtccacagcatccggcgcattctgatggtcgagcatcccgcgttcgcgtggaagcacatc
acgggcgatctctacgcgctcacgccgcgcgcgggcgcgttcgcgctcggcgcgggcgag
cgtatcgaagtgccgttcgtcggcgaatactggtaccagcgctatagcgatctgctgccg
cgcgcgtatgtcgtcgccgacggcaacgcggcgcccgccatcctcaagcacaacgatacc
gacgacgaaacccgctacgtcgaccgtattccgccaagcgccgacgccgccgccacgttc
gccgcgacgcccgcgcaagtgcaacgtgcgcgcgcggaagccgcgctgccgtcggcgcag
caagtcgcggcgcgcgcgctgccggccgttttgcgctcgacgcccaatgaaggcgtggcg
cagatcggcggcatcgagttgtcgatgtccggcctgacgtcgtcgcaacgcgcggcgctc
gaagcacgcgcggcgacgctcggtctcaccggcgcggccctgcgcgtgaacggacagatc
gcgggcggctcgctgcccgccgatatcgcgcgcgcgggcggttatcgcctgacgatcgca
cagggcggcgcaaacatcgacgcgttcgacgtcgccggacttttctatggcgtgcaaacg
ctcctgtctctcacgcccgcgggcggcggcaacgttccggcgatgacgatcgaagacgcg
ccgcgctttacgcatcgcggcatgcacgtcgatgtcgcgcgcaacttccgccagcccgcg
acaccgcgacgcctgatcgaccagatgggtgcgtacaagctcaatcgcctgcatctgcat
ctctccgacgacgaaggctggcgcatcgagattcccggcttgcccgaactcaccgatatc
ggcgcgaagcgttgccacgatctcaccgaaacgcgctgtctcgtgccgcagctcgcctcc
ggcccggacaatcgctcgggcggcgggtatctgagtcgcgccgactacgtggcgctcgtg
cgttatgcggcggaccgcttcgtcgagatcattccggagatcgacatgcccggccacgcg
cgcgccgcggtcgtctcgatggaagcgcggtttcagcgtctgagcgcgaaaggcgacaag
accggcgcgaacgcgtaccgtctgctcgatcccgccgatacctccaacgcgacgacggtc
cagttctacgatcgacgcagcttcatcaatccgtgcggggatggcgcgcagcgcttcgcg
tcgaaggtcatcggcgaaatcgcggcgatgcatcgcgaggccggcgcgccgctctccgtg
tggcacttcggcggcgacgaagccaagaacattctgctcggcgcgggcttccagccgctc
gacggcacggaccccggcaagggccgcgtcaatctcgcggcgcaggacaagccgtggggc
cgctcgccgcaatgcgcggcgctgatcgcgtcgggcaaggcggcttccgtcgacgaactg
ccgtcgatgttcgcgcgccaggtgagccagatcgtgcgcaacaacggcatcggcacgatg
gccgcgtggcaggacggcatcaagcacgctaaaggcccgcaggatttcgcgacatcgaac
acgatggtcacgatgtgggacacgattttctggggcgcgtcggacaccgtgcaggcgctg
agcgggcagggttacaagacggtgctcgcgctgccggactatttgtacttcgacttcccg
tatgccttcgatcagcgcgaacgcggctattactggggctcgcacggcacagacagcttc
aagaccttctcgctcgcgccggacaatctgccgcaaaacgcggaaatcatggccgatcgc
gacggcaagccgttcgaggtgacgagcgcgggcccggcgccgcacatcgaaggcattcag
gggcaggcgtgggctgaggtgatgcgcacggacccgcagttcgaatacatggtctatccg
cgtcttctggcgcttgcagaacgtgcatggcatcgggcggagtgggagcggccttatcgg
gatggcgagcgttacaagctcggcgacaccgacaaggtcgataaagccgcgctcgcgcgg
gattgggcggggttcgcgagcgtggtgcagaaccgcgagctggccaagctcaagcgcgcg
ggagccgtcatgcgcgagggcgcgggaagttga

DBGET integrated database retrieval system