KEGG   Burkholderia sp. YI23: BYI23_A012370Help
Entry
BYI23_A012370     CDS       T01711                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
byi  Burkholderia sp. YI23
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BYI23_A012370
Enzymes [BR:byi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BYI23_A012370
    3.5.1.-  
     BYI23_A012370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1393145..1393786
Genome map
AA seq 213 aa AA seqDB search
MKPVEDVLLVVDIQNDFMPGGALAVARGDEVVPVVNRLARAFSHVVLTQDWHPRSHVSFA
ANHAGRQPFETMTLPYGEQVLWPVHCVQDTDGAALHRDLHVPHARLVVRKGHHERVDSYS
AFVEADRVTPTGLEGYLRDVGATRVWLAGLATDYCVAWSALDARAAGFEVNVIEDACRAI
DLNGSLDKAWQDMHAAGVKRVKSDNIVKARETT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgtcgaagacgtgctcctcgtcgtcgatatccagaatgacttcatgccgggc
ggggcgctcgccgtcgcgcgcggcgacgaagtcgtgcccgtggtcaatcgcctcgcgcgc
gcgttctcgcatgtcgtgctgacgcaggactggcatccgcgttcgcacgtatcgttcgcg
gcgaatcacgcgggacgccagccgttcgagacgatgacgctgccttacggcgaacaggtg
ctgtggccagtgcattgcgtgcaggacaccgacggcgcggcgctgcatcgcgacttgcac
gtgccgcacgcgcggctcgtcgtgcgcaaggggcaccacgagcgcgtcgacagctattcg
gcgttcgttgaagccgatcgcgtgacgccgaccggcctcgaaggctatctgcgcgatgtc
ggcgcgacgcgcgtgtggctcgcgggactcgcgaccgactattgcgtcgcgtggtccgcg
ctcgatgcacgcgccgccggcttcgaggtcaacgtgatcgaagacgcgtgccgcgcgatc
gatctgaacggctcgctcgacaaggcctggcaagacatgcacgccgccggcgtgaagcgc
gtgaagtccgacaacatcgtgaaggcaagggagaccacatga

DBGET integrated database retrieval system