KEGG   Burkholderia sp. YI23: BYI23_A012370Help
Entry
BYI23_A012370     CDS       T01711                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
byi  Burkholderia sp. YI23
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:byi00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1393145..1393786
Genome map
AA seq 213 aa AA seqDB search
MKPVEDVLLVVDIQNDFMPGGALAVARGDEVVPVVNRLARAFSHVVLTQDWHPRSHVSFA
ANHAGRQPFETMTLPYGEQVLWPVHCVQDTDGAALHRDLHVPHARLVVRKGHHERVDSYS
AFVEADRVTPTGLEGYLRDVGATRVWLAGLATDYCVAWSALDARAAGFEVNVIEDACRAI
DLNGSLDKAWQDMHAAGVKRVKSDNIVKARETT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgtcgaagacgtgctcctcgtcgtcgatatccagaatgacttcatgccgggc
ggggcgctcgccgtcgcgcgcggcgacgaagtcgtgcccgtggtcaatcgcctcgcgcgc
gcgttctcgcatgtcgtgctgacgcaggactggcatccgcgttcgcacgtatcgttcgcg
gcgaatcacgcgggacgccagccgttcgagacgatgacgctgccttacggcgaacaggtg
ctgtggccagtgcattgcgtgcaggacaccgacggcgcggcgctgcatcgcgacttgcac
gtgccgcacgcgcggctcgtcgtgcgcaaggggcaccacgagcgcgtcgacagctattcg
gcgttcgttgaagccgatcgcgtgacgccgaccggcctcgaaggctatctgcgcgatgtc
ggcgcgacgcgcgtgtggctcgcgggactcgcgaccgactattgcgtcgcgtggtccgcg
ctcgatgcacgcgccgccggcttcgaggtcaacgtgatcgaagacgcgtgccgcgcgatc
gatctgaacggctcgctcgacaaggcctggcaagacatgcacgccgccggcgtgaagcgc
gtgaagtccgacaacatcgtgaaggcaagggagaccacatga

DBGET integrated database retrieval system