KEGG   Burkholderia sp. YI23: BYI23_A015550Help
Entry
BYI23_A015550     CDS       T01711                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
byi  Burkholderia sp. YI23
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1751200..1752105)
Genome map
AA seq 301 aa AA seqDB search
MKNPATAAASATPATSVFPVRSGVKPAAPGAANAKPVPGANKSAAQTHHAPRMSALRAAP
RPAERPLNAAAAATRKGAPNVALASTQTLASERVRERMVERLRANGVTDARVLNAMSVVP
RHMFVDPGLAAQAYEDAALPIGHHQTISKPSVVARMIELVAAGRTLAKVLEIGTGCGYQA
AVLSQVATEVYSIERVRPLSERAKLNLRPLRVPNIRLHYGDGRLGLPAAAPFDAIVIACA
GLDVPQALLDQLAVGGKLVAPVGSQAAQSQVLTLVTRVSATQWREEQLDRVFFVPLKSGV
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatccggcaacggctgccgcctccgccacgccggccacttccgtctttcccgtg
cgttccggcgtcaagcccgcggcgccgggcgcggcgaacgcgaaaccggttccgggtgcg
aacaagagcgccgcgcagacgcatcacgcgccgcgcatgagcgcattgcgcgccgcgccg
cgcccggccgagcgccccctgaatgccgccgcggccgccacccgaaagggcgcgccgaac
gtcgcgctcgcgagcacgcagacgctcgcctcggaacgggtgcgcgagcgcatggtcgaa
cggctgcgcgccaacggcgtgaccgacgcgcgcgtgctgaacgcgatgtccgtggtgccg
cgccacatgttcgtcgatccggggctcgccgcgcaggcttacgaagatgccgcgttgccc
atcggccatcaccagaccatctccaagccgtccgtcgtggcgcgcatgatcgaactggtc
gcggccgggcgcacgctcgccaaggtgctggagatcggcaccggctgcggttatcaggcg
gcggtgctgtcgcaggtcgccaccgaggtttattcgatcgagcgcgtgcgcccgctgtcg
gagcgcgcgaagctcaaccttcggccgctgcgcgtgccgaacatcagactgcattacggc
gacggccgcctgggcttgcccgcggccgcgccgttcgacgcgatcgtgatcgcctgcgcc
ggcctcgacgtgccgcaagccttgctcgatcaactggcggtgggcggcaagctcgtcgca
ccggtcggctcgcaggccgcgcagtcgcaagtgctcacgctcgtgacgcgcgtgtcggcc
acgcaatggcgtgaagagcagctcgatcgcgttttctttgtacccttaaaatccggagtg
atttga

DBGET integrated database retrieval system