KEGG   Burkholderia sp. YI23: BYI23_A017030Help
Entry
BYI23_A017030     CDS       T01711                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
byi  Burkholderia sp. YI23
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BYI23_A017030
   01230 Biosynthesis of amino acids
    BYI23_A017030
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BYI23_A017030
   00051 Fructose and mannose metabolism
    BYI23_A017030
   00562 Inositol phosphate metabolism
    BYI23_A017030
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BYI23_A017030
Enzymes [BR:byi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BYI23_A017030
Exosome [BR:byi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BYI23_A017030
  Exosomal proteins of bladder cancer cells
   BYI23_A017030
  Exosomal proteins of melanoma cells
   BYI23_A017030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1918916..1919689)
Genome map
AA seq 257 aa AA seqDB search
MSRERAKLVVGNWKMHGRIGDNATLLTEVAAGASALQKGVRVGVCVPCPYLAQSQALLAG
SVVQWGIQDVSAHEGGAYTGEVAAEMAADFGVTYAIVGHSERRAYHRESPELVAAKAKRA
IEAGLTPIVCVGETLEERESAQTEQVIGTQLDAVLLVLTEEQAAGIVVAYEPVWAIGTGK
TARPLQAQDVHAFLRRKLLEKGASVAHVPLLYGGSVKPENAEELFGQKDIDGGLIGGASL
KSKDFLAICRAAQTVLH
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtccagagaacgagcgaaactggtggtgggcaactggaagatgcacggccgcatcggt
gacaacgcgaccttgctgaccgaagtcgccgcaggtgcatcggctttgcaaaagggcgtg
cgcgtcggtgtgtgcgtgccgtgcccgtatctcgcgcaatcgcaggcgctcctcgcgggt
tcggtcgtgcagtggggcattcaggacgtgtcggcgcatgagggtggggcctacaccggc
gaagtcgcagccgaaatggcggcggacttcggcgtgacctacgcgatcgtcgggcattcg
gagcgacgcgcgtatcatcgcgaaagtccggaactcgtcgcggcgaaggcaaagcgcgcg
atcgaggcgggtctcacgccgatcgtctgcgtcggcgagacgctcgaagaacgcgagtcc
gcgcagacggagcaggtcatcggcacgcaactcgacgccgttctgctcgtgctgacggaa
gagcaggcggctggcatcgtggtcgcctacgaacccgtctgggcgatcggcacgggcaag
accgcgcggccgctgcaggcacaggacgttcacgcattcctgcgccgcaagctgctggag
aagggggcgtcggtagcgcacgtgccgctcttgtacggcggcagcgtgaagcccgagaac
gcggaagaactgttcgggcagaaggacatcgacggcgggctgatcggcggcgcgtcgctg
aagtcgaaggattttctggcgatctgccgggccgcgcaaaccgtgttgcattga

DBGET integrated database retrieval system