KEGG   Burkholderia sp. YI23: BYI23_A017030Help
Entry
BYI23_A017030     CDS       T01711                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00010  Glycolysis / Gluconeogenesis
byi00051  Fructose and mannose metabolism
byi00562  Inositol phosphate metabolism
byi00710  Carbon fixation in photosynthetic organisms
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01120  Microbial metabolism in diverse environments
byi01130  Biosynthesis of antibiotics
byi01200  Carbon metabolism
byi01230  Biosynthesis of amino acids
Module
byi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
byi_M00002  Glycolysis, core module involving three-carbon compounds
byi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BYI23_A017030
   00051 Fructose and mannose metabolism
    BYI23_A017030
   00562 Inositol phosphate metabolism
    BYI23_A017030
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BYI23_A017030
Enzymes [BR:byi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BYI23_A017030
Exosome [BR:byi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BYI23_A017030
  Exosomal proteins of bladder cancer cells
   BYI23_A017030
  Exosomal proteins of melanoma cells
   BYI23_A017030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AET89541
UniProt: G8M4R1
Position
1:complement(1918916..1919689)
Genome map
AA seq 257 aa AA seqDB search
MSRERAKLVVGNWKMHGRIGDNATLLTEVAAGASALQKGVRVGVCVPCPYLAQSQALLAG
SVVQWGIQDVSAHEGGAYTGEVAAEMAADFGVTYAIVGHSERRAYHRESPELVAAKAKRA
IEAGLTPIVCVGETLEERESAQTEQVIGTQLDAVLLVLTEEQAAGIVVAYEPVWAIGTGK
TARPLQAQDVHAFLRRKLLEKGASVAHVPLLYGGSVKPENAEELFGQKDIDGGLIGGASL
KSKDFLAICRAAQTVLH
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtccagagaacgagcgaaactggtggtgggcaactggaagatgcacggccgcatcggt
gacaacgcgaccttgctgaccgaagtcgccgcaggtgcatcggctttgcaaaagggcgtg
cgcgtcggtgtgtgcgtgccgtgcccgtatctcgcgcaatcgcaggcgctcctcgcgggt
tcggtcgtgcagtggggcattcaggacgtgtcggcgcatgagggtggggcctacaccggc
gaagtcgcagccgaaatggcggcggacttcggcgtgacctacgcgatcgtcgggcattcg
gagcgacgcgcgtatcatcgcgaaagtccggaactcgtcgcggcgaaggcaaagcgcgcg
atcgaggcgggtctcacgccgatcgtctgcgtcggcgagacgctcgaagaacgcgagtcc
gcgcagacggagcaggtcatcggcacgcaactcgacgccgttctgctcgtgctgacggaa
gagcaggcggctggcatcgtggtcgcctacgaacccgtctgggcgatcggcacgggcaag
accgcgcggccgctgcaggcacaggacgttcacgcattcctgcgccgcaagctgctggag
aagggggcgtcggtagcgcacgtgccgctcttgtacggcggcagcgtgaagcccgagaac
gcggaagaactgttcgggcagaaggacatcgacggcgggctgatcggcggcgcgtcgctg
aagtcgaaggattttctggcgatctgccgggccgcgcaaaccgtgttgcattga

DBGET integrated database retrieval system