KEGG   Burkholderia sp. YI23: BYI23_A018140Help
Entry
BYI23_A018140     CDS       T01711                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
byi  Burkholderia sp. YI23
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BYI23_A018140
   00052 Galactose metabolism
    BYI23_A018140
   00500 Starch and sucrose metabolism
    BYI23_A018140
   00520 Amino sugar and nucleotide sugar metabolism
    BYI23_A018140
Enzymes [BR:byi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BYI23_A018140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2044631..2045512
Genome map
AA seq 293 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKDKLLELVRSIKPSHVDCFYVRQAEALGLGHAVLCAEK
LVGDNPFAVILADDLLYGKPPVMSQMIEVFDHYHSSVIGVEEIPQQDSKSYGIIDGKEWE
DNIFKLSGIVEKPEPAVAPSNLGVVGRYVLKPRVFDHIRALKPGAGGELQLTDAIQSLLS
DEQVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVKQEFEEYLRNRAPILEG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagttaccaaagcggttttccccgtcgcgggtctgggcacgcggtttcttccc
gcgaccaaggccagcccgaaggaaatgctgccagtcgtggacaagccgctgattcagtat
gcggtcgaagaagcaatggcggccggcattaccgaaatgatcttcgtcaccggccgcagc
aagcgtgccatcgaagaccacttcgacaagtcctatgaaatcgaggcggagctcgaagcg
cgcggcaaggacaagctgctcgaactcgtgcgcagcatcaagcccagccatgtcgactgc
ttctatgtgcgtcaggccgaagcgctcggtctcggccacgccgtgctgtgcgcggaaaag
ctcgtcggcgacaacccgttcgccgtgatcctcgcggacgacctgctgtacggcaagccg
cccgtgatgtcgcagatgatcgaagtcttcgaccactatcacagctcggtcatcggcgtc
gaagagatcccgcagcaggattcgaagtcgtacggcatcatcgacggcaaggaatgggaa
gacaacatcttcaagctgtcgggcatcgtcgagaagccggaaccggcggtcgcgccgtcg
aacctgggcgtggtgggccgttacgtgctgaagccgcgcgttttcgatcacatccgcgcg
ctgaagccgggcgcgggcggcgaactgcaactgacggacgcgattcaatcgctgctgtcg
gacgagcaagtgctcgcgtacaagtatcacggcacgcgtttcgactgcggcagcaagctg
ggttatctgaaggcgacggtggaattcgcgctgcgccacccggaagtgaagcaggaattc
gaggaatatctgcgcaatcgcgcgccgattctcgaaggctga

DBGET integrated database retrieval system