KEGG   Burkholderia sp. YI23: BYI23_A018890Help
Entry
BYI23_A018890     CDS       T01711                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
byi  Burkholderia sp. YI23
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BYI23_A018890
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BYI23_A018890
Enzymes [BR:byi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BYI23_A018890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2133799..2134827)
Genome map
AA seq 342 aa AA seqDB search
MKRTPGPVMYDVAGTTLSDADIERLTHPMTGGIILFARHFQDRAQLVALTDAIRAVRDDI
LIAVDHEGGRVQRFRTDGFTVLPAPGKLGELWDRDVLAATKTATAFGYVLAAELRACGID
MSFTPVLDLNYGQSKVIGDRALHGDPRVVAMLAKSLNHGLALAGMANCGKHFPGHGFAEA
DSHVALPTDDRPLDDILAADVRPYDWLGLSLASVIPAHVIYTQVDDKPAGFSRIWLQDIL
RGKLGFDGAIFSDDLSMEAARAGGTLTEAATAALSAGCDMVLICNQPEEAGKVLEQLRYT
PSKISQQRLRQMRPRGKALRWSKLQAQAEYQAARALIDDMLR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcactcccggccccgtcatgtacgacgtcgccggcacgacgctctccgacgcg
gatatcgagcgcctcacgcatccgatgaccggcggcatcattcttttcgcgcggcatttt
caggaccgcgcgcaactcgtcgcgctgaccgatgcgatccgggcggtgcgcgacgacatc
ctgatcgccgtcgatcacgaaggcggccgcgtgcagcgctttcgcaccgatggcttcacg
gtgctgcccgcgccgggcaagctcggtgaactgtgggaccgtgacgtgctcgccgcgacc
aagaccgcgaccgcgttcggctatgtgctcgcggcggagttgcgcgcgtgcggcatcgac
atgagcttcacgccggtgctggatctgaactacggacagtcgaaggtgatcggcgaccgc
gcgctgcacggcgatccgcgcgtcgtcgcgatgctcgcgaagagcctgaaccacggtctc
gcgctcgcgggcatggcgaactgcggcaagcactttcccggtcatggatttgccgaggcc
gattcgcacgttgcgctgccgaccgacgatcgcccgctcgacgacatcctcgccgccgat
gtgcgcccgtacgactggctcggcctgtcgctggcgtcggtgattccggcgcacgtcatc
tacacgcaggtcgacgacaagcccgccggtttctcgcgcatctggctgcaggacattctg
cgcggcaagctcggcttcgacggcgcgatcttcagcgacgatctctcgatggaagccgcg
cgcgcaggcggcacgctcaccgaggccgcgaccgccgcgctgagcgcgggctgcgacatg
gtgctgatctgcaatcagccggaggaggcgggcaaggtgctggagcagttgcgctacacg
ccgtcgaaaatctcgcagcagcgcttgaggcagatgcgcccgcgcggcaaggcgttgcgc
tggagcaagctccaggcgcaggccgagtatcaggcggcccgcgcgctcatcgacgacatg
ttgcggtaa

DBGET integrated database retrieval system