KEGG   Burkholderia sp. YI23: BYI23_A019500Help
Entry
BYI23_A019500     CDS       T01711                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
byi  Burkholderia sp. YI23
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BYI23_A019500
   00670 One carbon pool by folate
    BYI23_A019500
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BYI23_A019500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2195906..2196397
Genome map
AA seq 163 aa AA seqDB search
MTTLTLIVARARNGVIGRDNQLPWRLPEDLAFFKRTTMGAPIIMGRKTHESIGRPLPGRR
NIVVSRDASRRYEGCDVVTSLDAALALAPADEAFLIGGAQLYRDGFERADKLIVTEIDAD
FDGDTRFPAPDPAHWREVSRETHRAAPPNAFDFAFVAYERIRA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctgactctgatcgtcgcccgcgcgcgcaatggcgtgatcggacgcgacaac
caacttccctggcggctgcccgaagacctcgcgttcttcaagcgcacgacgatgggcgcg
cccatcatcatgggccgcaagacgcacgaatcgatcggccggccgctgccggggcggcgc
aatatcgtcgtgtcccgcgatgcgtcgcggcgctacgagggctgcgatgtcgtcacgagc
ctcgacgccgcgctcgcgctggccccggccgacgaagcgtttctgatcggcggcgcgcag
ttgtatcgcgacggcttcgaacgcgcggacaagctgatcgtcaccgaaatcgacgcggac
ttcgacggcgacacgcgtttccccgcgcccgatccggcgcactggcgggaggtgtcgcgc
gagacgcaccgcgccgcgccgccgaacgcattcgatttcgcgttcgtcgcttacgagcgc
attcgcgcctga

DBGET integrated database retrieval system