KEGG   Burkholderia sp. YI23: BYI23_A020860Help
Entry
BYI23_A020860     CDS       T01711                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
byi  Burkholderia sp. YI23
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BYI23_A020860
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BYI23_A020860
Enzymes [BR:byi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BYI23_A020860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2361587..2362138)
Genome map
AA seq 183 aa AA seqDB search
MAIQVTATALPEVKIIEPKVFGDARGFFYESFNAREFAEHVESGVEFVQDNHSRSAKGVL
RGLHYQIQHAQGKLVRVVEGEVFDVAVDIRKSSPNFGKWVGVNLSEENHRQLWVPPGFAH
GFVVLSESAQFLYKTTDYWFQAHERSIVWNDPEIGIEWPIDFEPLLAAKDAAGKRLAEAE
VFA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggccatccaggtaacggcaacggcgttgcccgaagtcaagatcatcgagccgaaagtg
ttcggcgatgcgcgcggcttcttttacgagagcttcaacgcgcgtgaattcgcggagcac
gtcgagagcggtgtcgagttcgtgcaggacaatcattcgcgctcggcaaagggcgtgctg
cgcggactgcactatcagattcagcatgcgcagggcaagctcgtgcgcgtcgtggaaggc
gaagtgttcgatgtcgcggtcgatatccgcaagagttcgccgaacttcggcaagtgggtc
ggcgtgaacctgtcggaggaaaaccaccggcagttgtgggtgccgccgggtttcgcgcac
ggctttgtcgtgctgtcggagtcggcgcagtttctctacaagacgaccgattactggttc
caggcgcacgagcgcagcatcgtgtggaacgacccggagatcggcatcgaatggccgatc
gacttcgagccgctgctcgcggcgaaggatgcggctggcaagcggttggctgaagctgag
gtgtttgcatga

DBGET integrated database retrieval system