KEGG   Burkholderia sp. YI23: BYI23_A020920Help
Entry
BYI23_A020920     CDS       T01711                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
byi  Burkholderia sp. YI23
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:byi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:byi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2367350..2368375)
Genome map
AA seq 341 aa AA seqDB search
MNTAIQGAAESGAPASDKFRYGFLKGNPQLTKNGELKHLLTIEGLPRSIVTHILDTAEQF
VSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAAKRLSADVLNLNINASSTSKGES
LLDTINNLSAMHADMFVVRHASSGAPYLIAEHCAPHVHVINAGDGRHAHPTQGLLDMYTI
RHYKRDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVRAIGPRTLLPGNLDQMGVHVY
HNLDEGLKGVDVIIMLRLQNERMSGALLPSAQEYFKSWGLTPERLALAAPDAIVMHPGPM
NRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGNSD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgctattcagggcgcagccgaatcgggcgcgcctgcctctgacaagttccgg
tacggctttctcaaaggcaatccgcagctcacgaagaacggcgagctgaagcatctgctc
accatcgaaggattgccgcgctcgatcgtcacgcacattctcgacaccgccgagcagttc
gtgagcgtcaccgaccgagaagtgaaaaaggtgccgcttttgcgcggcaagtcggtgttc
aaccttttcttcgagaactcgacgcgcacgcgcaccacgttcgagatcgcggcgaagcgc
ctctcggcggacgtgctgaacctgaacatcaatgcgtcctcgacgagcaagggcgaatcg
ctgctcgacaccatcaacaatctctccgcgatgcacgccgacatgttcgtcgtgcgtcac
gcgtcgagcggcgcgccgtatctgatcgccgagcattgcgcgccgcacgtgcacgtgatc
aacgcgggcgatggccgtcatgcgcatccgacgcaggggctcctcgacatgtacacgatc
cgccattacaagcgcgactttacgaagctgcgcgtggcgatcgtcggcgacatcctgcat
tcgcgggtggcgcgctcggacattcacgcgctcaccacgctcggcgtgcccgaagtgcgc
gcgatcggtccgcgcacgctcttgccgggcaatctcgatcagatgggcgtgcacgtctat
cacaacctcgacgaaggcctgaagggcgtcgacgtgatcatcatgctgcgcctgcagaac
gagcgcatgagcggcgcgctgctgccgtcggcgcaggagtatttcaagagctggggcctc
acgcccgagcgcctcgcgctcgccgcgcccgacgccatcgtgatgcaccccggaccgatg
aaccgcggcgtcgaaatcgactcgcaagtggccgacggcccgcagtcggtcattttgaat
caggtgactttcggcatcgccgtgcgcatggcggtgatgggcatcgtggctgggaatagc
gactaa

DBGET integrated database retrieval system