KEGG   Burkholderia sp. YI23: BYI23_A023110Help
Entry
BYI23_A023110     CDS       T01711                                 

Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00030  Pentose phosphate pathway
byi00040  Pentose and glucuronate interconversions
byi00710  Carbon fixation in photosynthetic organisms
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01120  Microbial metabolism in diverse environments
byi01130  Biosynthesis of antibiotics
byi01200  Carbon metabolism
byi01230  Biosynthesis of amino acids
Module
byi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
byi_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BYI23_A023110
   00040 Pentose and glucuronate interconversions
    BYI23_A023110
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BYI23_A023110
Enzymes [BR:byi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     BYI23_A023110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim QRPTase_C His_biosynth
Motif
Other DBs
NCBI-ProteinID: AET90149
UniProt: G8M8A4
Position
1:2608396..2609091
Genome map
AA seq 231 aa AA seqDB search
MAQFHIAPSILSADFSRLGEEVRNVVAAGADWIHFDVMDNHYVPNLTIGPMVCEAIRPHV
DVPIDVHLMVRPVDRIVPDFAKAGANVISFHPEGSDHIDRTLSLIRDHGCKAGLVFNPAT
PLNYLDHVMDKVDLVLIMSVNPGFGGQSFIPEALNKLREARARINAYRDRTGREIHLEVD
GGVKVDNIAEIAAAGADSFVAGSAIFGKPDYKQVIDAMRAELAKAESGAKA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaattccacatcgctcccagcatcctgtccgccgatttctcccgccttggcgag
gaagtccgcaacgtcgtcgccgctggcgccgactggatccacttcgacgtcatggacaac
cactacgtgccgaatctcacgatcggcccgatggtgtgcgaggccatccgcccgcacgtc
gacgttcccattgacgtgcatctgatggtgcgtccggttgaccgcatcgtgcccgatttc
gcgaaagccggcgccaatgtgatcagttttcatccggaaggttcggatcacatcgaccgc
acgctgtcgctgatccgcgatcacggctgcaaggcggggctcgtgttcaatcccgcgacg
ccgctcaattatctggatcatgtgatggacaaggtcgatcttgtgctgatcatgtcggtc
aacccgggtttcggcggacagtcgttcattcccgaagcgctcaacaagctgcgcgaggcg
cgtgcgcgcatcaacgcgtatcgcgatcgcacgggccgcgagatccatctcgaagtcgac
ggcggcgtgaaggtcgacaacatcgcggaaatcgcggcggccggcgccgactcgttcgtc
gccggctcggccattttcggcaagcctgactacaagcaggttatcgacgcgatgcgcgcg
gaactggcgaaagccgaatcgggagcgaaagcatga

DBGET integrated database retrieval system