KEGG   Burkholderia sp. YI23: BYI23_A023110Help
Entry
BYI23_A023110     CDS       T01711                                 

Definition
ribulose-phosphate 3-epimerase
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
byi  Burkholderia sp. YI23
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BYI23_A023110
   01230 Biosynthesis of amino acids
    BYI23_A023110
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BYI23_A023110
   00040 Pentose and glucuronate interconversions
    BYI23_A023110
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BYI23_A023110
Enzymes [BR:byi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     BYI23_A023110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2608396..2609091
Genome map
AA seq 231 aa AA seqDB search
MAQFHIAPSILSADFSRLGEEVRNVVAAGADWIHFDVMDNHYVPNLTIGPMVCEAIRPHV
DVPIDVHLMVRPVDRIVPDFAKAGANVISFHPEGSDHIDRTLSLIRDHGCKAGLVFNPAT
PLNYLDHVMDKVDLVLIMSVNPGFGGQSFIPEALNKLREARARINAYRDRTGREIHLEVD
GGVKVDNIAEIAAAGADSFVAGSAIFGKPDYKQVIDAMRAELAKAESGAKA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaattccacatcgctcccagcatcctgtccgccgatttctcccgccttggcgag
gaagtccgcaacgtcgtcgccgctggcgccgactggatccacttcgacgtcatggacaac
cactacgtgccgaatctcacgatcggcccgatggtgtgcgaggccatccgcccgcacgtc
gacgttcccattgacgtgcatctgatggtgcgtccggttgaccgcatcgtgcccgatttc
gcgaaagccggcgccaatgtgatcagttttcatccggaaggttcggatcacatcgaccgc
acgctgtcgctgatccgcgatcacggctgcaaggcggggctcgtgttcaatcccgcgacg
ccgctcaattatctggatcatgtgatggacaaggtcgatcttgtgctgatcatgtcggtc
aacccgggtttcggcggacagtcgttcattcccgaagcgctcaacaagctgcgcgaggcg
cgtgcgcgcatcaacgcgtatcgcgatcgcacgggccgcgagatccatctcgaagtcgac
ggcggcgtgaaggtcgacaacatcgcggaaatcgcggcggccggcgccgactcgttcgtc
gccggctcggccattttcggcaagcctgactacaagcaggttatcgacgcgatgcgcgcg
gaactggcgaaagccgaatcgggagcgaaagcatga

DBGET integrated database retrieval system