KEGG   Burkholderia sp. YI23: BYI23_A023110Help
Entry
BYI23_A023110     CDS       T01711                                 

Definition
ribulose-phosphate 3-epimerase
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
byi  Burkholderia sp. YI23
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:byi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:byi01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:byi00030]
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:byi00040]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:byi00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2608396..2609091
Genome map
AA seq 231 aa AA seqDB search
MAQFHIAPSILSADFSRLGEEVRNVVAAGADWIHFDVMDNHYVPNLTIGPMVCEAIRPHV
DVPIDVHLMVRPVDRIVPDFAKAGANVISFHPEGSDHIDRTLSLIRDHGCKAGLVFNPAT
PLNYLDHVMDKVDLVLIMSVNPGFGGQSFIPEALNKLREARARINAYRDRTGREIHLEVD
GGVKVDNIAEIAAAGADSFVAGSAIFGKPDYKQVIDAMRAELAKAESGAKA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaattccacatcgctcccagcatcctgtccgccgatttctcccgccttggcgag
gaagtccgcaacgtcgtcgccgctggcgccgactggatccacttcgacgtcatggacaac
cactacgtgccgaatctcacgatcggcccgatggtgtgcgaggccatccgcccgcacgtc
gacgttcccattgacgtgcatctgatggtgcgtccggttgaccgcatcgtgcccgatttc
gcgaaagccggcgccaatgtgatcagttttcatccggaaggttcggatcacatcgaccgc
acgctgtcgctgatccgcgatcacggctgcaaggcggggctcgtgttcaatcccgcgacg
ccgctcaattatctggatcatgtgatggacaaggtcgatcttgtgctgatcatgtcggtc
aacccgggtttcggcggacagtcgttcattcccgaagcgctcaacaagctgcgcgaggcg
cgtgcgcgcatcaacgcgtatcgcgatcgcacgggccgcgagatccatctcgaagtcgac
ggcggcgtgaaggtcgacaacatcgcggaaatcgcggcggccggcgccgactcgttcgtc
gccggctcggccattttcggcaagcctgactacaagcaggttatcgacgcgatgcgcgcg
gaactggcgaaagccgaatcgggagcgaaagcatga

DBGET integrated database retrieval system