KEGG   Burkholderia sp. YI23: BYI23_A023160Help
Entry
BYI23_A023160     CDS       T01711                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
byi  Burkholderia sp. YI23
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BYI23_A023160
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BYI23_A023160
Enzymes [BR:byi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BYI23_A023160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2613322..2614107
Genome map
AA seq 261 aa AA seqDB search
MSDILDRIIAVKRDEIRAAEQSAPLEELKLEASSRDLRDFVGALRAKHAANQAAVIAEVK
KASPSKGVLREHFVPADIARSYEKGGAACLSVLTDVQFFKGSVAYLEEARAACSLPVLRK
DFIIDPYQIIEARAMGADCILLIAAALELSQMQDLEAYAHSLGLAVLVEVHDADELRDAL
TLKTPLIGINNRNLRTFETTIETTIGMLESVPDDRIVVTESGILSRVDVDRLRAMRVHSF
LVGEAFMRADDPGAELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacattctggatcgcatcatcgcggtcaagcgcgatgaaattcgggccgcggag
caaagcgcgccgctcgaagagctgaagctcgaagccagttcgcgcgacctgcgcgatttc
gtcggcgcgttgcgcgcgaagcatgcggccaatcaggccgccgtcatcgcggaagtgaag
aaagcgagcccgtcgaagggcgtgctgcgcgagcatttcgtacccgccgacatcgcgcgt
tcgtacgaaaagggcggcgccgcctgtctttccgtgctcaccgacgtacagttcttcaag
ggcagcgtcgcgtatctggaggaagcgcgcgccgcgtgcagcttgccggtgctgcgcaag
gacttcatcatcgatccgtatcagatcatcgaggcgcgcgcgatgggcgcggactgcatc
ctgctgatcgccgccgcgctcgaactctcgcagatgcaggatctcgaagcctacgcgcat
tcgctcggcctcgcggtgctggtcgaagtgcacgacgccgacgaactgcgcgacgcgctc
acgctcaagacgccgctcatcggcatcaacaaccgcaacctgcgtaccttcgaaacgacg
atcgagacgaccatcggcatgctggaaagcgttccggacgaccgcatcgtcgtgacggag
tcgggcattctgtcgcgtgtcgatgtcgaccggctgcgcgccatgcgcgtgcactcgttc
ctcgtcggcgaggcgttcatgcgcgccgacgatccgggcgccgagcttgcgcgcatgttc
ttctga

DBGET integrated database retrieval system