KEGG   Burkholderia sp. YI23: BYI23_A023210Help
Entry
BYI23_A023210     CDS       T01711                                 

Gene name
dsbC
Definition
putative thiol-disulfide interchange protein, DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
byi  Burkholderia sp. YI23
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2618328..2619050)
Genome map
AA seq 240 aa AA seqDB search
MSRFALATAAAFAVTLGLGCSAQADQTTDKLKSTLESRMGDATVKSIQKTEIPGLYEVNL
GSQIVYSDATGNYVLIGDLVDTRSSRNLTEARLAETNKIDFAKLPLENAVKVVKGNGSRK
IAVFSDPNCPYCKQLESTLKSIDNVTVYTFLYPVLSPDSTAKSKSIWCSKDRGMTWESWM
LDHKAPSMAASCDTTAIDKNLKLGRSMNVTGTPTVFLADGRRLPGAVPADRLEKELSAVR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atttcccgctttgccctcgcgacggccgccgcattcgccgtgacgctcggcctgggctgc
tcggcgcaggccgaccagaccaccgacaaactcaaatcgacgctggaatcgcgcatgggc
gacgccaccgtcaagagcatccagaagaccgagattccgggcctctacgaagtgaatctc
ggctcgcagatcgtctatagcgatgcgaccggcaactacgtgctgattggcgatctcgtc
gatacgcgcagcagccggaatctcaccgaagcgcggctcgcggaaaccaacaagatcgat
ttcgcgaagttgccgctcgaaaacgcggtgaaggtcgtgaagggcaacggcagccgcaag
atcgcggtgttctccgatccgaattgcccgtactgcaagcagctcgaatcgacgctgaag
tccatcgacaacgtgaccgtctacaccttcctgtatccggtgctctcgcccgattcgacg
gccaagtcgaagtcgatctggtgctcgaaggatcgcggcatgacgtgggagagctggatg
ctcgatcacaaggcgccgagcatggcggcatcgtgcgacacgaccgccatcgacaagaat
ctgaagctcggccgctcgatgaacgtcaccggcacgccgaccgtgtttctcgccgatggc
cggcgtctgccgggcgccgtgcccgccgaccggctcgaaaaagaactgtccgccgtgcgc
tga

DBGET integrated database retrieval system